Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase ATL23 (ATL23)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance (with associated additional charges).
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
ATL23; At5g42200; MJC20.31; E3 ubiquitin-protein ligase ATL23; RING-H2 finger protein ATL23; RING-type E3 ubiquitin transferase ATL23
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-163
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ATL23
Target Protein Sequence
MHYTRISPALVPSLSPTAAAESSGGGTMIATVFMALLLPCVGMCIVFLIYLFLLWCSTRR RIERLRFAEPVKPVTGKGLSVLELEKIPKLTGRELAVIARSTECAVCLEDIESGQSTRLV PGCNHGFHQLCADTWLSNHTVCPVCRAELAPNLPQCNENQSPC
Uniprot No.

Target Background

Function
Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase ATL23 (ATL23) is an E3 ubiquitin-protein ligase that catalyzes polyubiquitination in vitro with ubiquitin-conjugating enzymes E2 UBC8, UBC10, UBC11, UBC28, and UBC29.
Database Links

KEGG: ath:AT5G42200

STRING: 3702.AT5G42200.1

UniGene: At.43326

Protein Families
RING-type zinc finger family, ATL subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Arabidopsis thaliana E3 ubiquitin-protein ligase ATL23?

ATL23 belongs to the Arabidopsis Tóxicos en Levadura (ATL) family of RING-H2 type E3 ubiquitin ligases in Arabidopsis thaliana. Like other ATL family members, ATL23 contains a RING-H2 finger domain that is essential for its E3 ligase activity, which facilitates the transfer of ubiquitin molecules to target proteins, marking them for degradation via the 26S proteasome system . The recombinant form refers to the protein produced through genetic engineering techniques, typically in bacterial or other expression systems, for research purposes.

How does ATL23 relate to other ATL family members?

ATL23 is part of the larger ATL family that includes well-characterized members such as ATL2. Although specific research on ATL23 is limited in the available literature, studies on ATL2 show that it functions as a plasma membrane-integrated protein with RING-H2-type E3 ubiquitin ligase activity and plays an essential role in plant defense responses against fungal pathogens . By analogy, ATL23 likely shares structural similarities with ATL2, including a transmembrane domain, a RING-H2 finger domain, and possibly a similar subcellular localization pattern.

What is the general function of E3 ubiquitin ligases in Arabidopsis?

E3 ubiquitin ligases are crucial components of the ubiquitin-proteasome system that regulate protein turnover in plants. In Arabidopsis, approximately 5% of the genome codes for proteins involved in the ubiquitination pathway, with more than one thousand genes corresponding to E3 ubiquitin ligases . These enzymes specifically recognize target proteins for ubiquitination, which typically leads to their degradation via the 26S proteasome. E3 ubiquitin ligases in Arabidopsis are involved in regulating numerous biological processes including:

  • Hormonal control of vegetative growth

  • Plant reproduction

  • Light response

  • Biotic and abiotic stress tolerance

  • DNA repair

  • Defense responses against pathogens

What types of E3 ubiquitin ligases exist in plants?

E3 ubiquitin ligases in plants can be classified into several major categories:

  • HECT E3 ligases: Contain a conserved 350 amino acid C-terminal HECT domain. Arabidopsis has seven HECT genes named UPL1-UPL7 .

  • RING-finger E3 ligases: Include the ATL family, which contains a RING-H2 finger domain. These can function as:

    • Single-subunit E3 ligases

    • Multi-subunit E3 ligases (such as SCF complexes)

  • Cullin-based E3 ligase complexes:

    • SCF complexes (SKP1, CUL1, F-box protein, and RBX1)

    • CUL3-BTB complexes (CUL3, BTB/POZ domain protein, and RBX1)

The ATL family, including ATL23, belongs to the RING-finger type of E3 ligases.

What are optimal experimental designs for studying ATL23 expression?

Based on experimental designs employed for similar proteins, a factorial approach is recommended for optimizing ATL23 expression . This approach allows for the simultaneous evaluation of multiple variables that affect protein expression.

Recommended factorial design elements for ATL23 expression:

VariableLow Level (-1)Center Point (0)High Level (+1)
IPTG concentration (mM)0.10.20.5
Temperature (°C)182530
Induction time (hours)4616
Cell density at induction (OD600)0.50.81.2
Media compositionMinimalSemi-richRich
pH6.57.07.5
Strain typeBL21(DE3)RosettaArctic Express

This type of experimental design allows researchers to identify optimal conditions while using fewer experiments than would be required with a one-factor-at-a-time approach . Statistical analysis of the results using analysis of variance (ANOVA) can identify significant variables and their interactions, leading to more efficient optimization of expression conditions .

What are the challenges in recombinant expression of ATL23?

Recombinant expression of plant E3 ubiquitin ligases like ATL23 presents several challenges that researchers should anticipate:

  • Protein solubility issues: RING-finger proteins often form inclusion bodies in bacterial expression systems due to improper folding .

  • Maintaining structural integrity: The RING-H2 domain contains zinc-binding sites that are crucial for protein function and may not fold properly in heterologous systems .

  • Post-translational modifications: E3 ligases often undergo modifications that may not occur correctly in bacterial systems.

  • Membrane association: Many ATL family proteins, including ATL2, are integrated into the plasma membrane , which can complicate expression and purification.

  • Functional activity: Maintaining the E3 ligase activity of the recombinant protein is essential for functional studies.

Solutions based on experimental evidence:

  • Use lower induction temperatures (16-18°C) to promote proper folding

  • Add zinc to the culture medium and purification buffers (0.1-0.5 mM ZnSO₄)

  • Co-express with chaperones to improve folding

  • Consider eukaryotic expression systems (yeast, insect cells) for improved post-translational modifications

  • Use solubility-enhancing fusion tags (MBP, SUMO, etc.)

How can biological activity of recombinant ATL23 be assessed?

The E3 ubiquitin ligase activity of recombinant ATL23 can be evaluated through several approaches:

  • In vitro ubiquitination assay:

    • Incubate purified recombinant ATL23 with:

      • E1 enzyme (ubiquitin-activating enzyme)

      • E2 enzyme (ubiquitin-conjugating enzyme, preferably from UBC8 family)

      • Ubiquitin (often tagged for detection)

      • ATP regeneration system

    • Detect ubiquitination by western blotting

  • Identification of conserved catalytic residues:

    • Based on studies of ATL2, the conserved cysteine residue in the RING-H2 domain is critical for E3 ligase activity

    • Mutational analysis (e.g., cysteine to alanine) can confirm essential residues for catalytic activity

  • Substrate identification and validation:

    • Yeast two-hybrid screening to identify potential substrates

    • Pull-down assays to confirm direct interactions

    • In vivo and in vitro ubiquitination assays with potential substrates

What are the current hypotheses about ATL23's role in plant immunity?

Based on studies of other ATL family members, particularly ATL2, several hypotheses about ATL23's potential role in plant immunity can be proposed:

  • Pathogen-associated molecular pattern (PAMP) responsiveness: ATL2 is rapidly induced by chitin, suggesting ATL23 might also be responsive to specific PAMPs .

  • Defense signaling regulation: Like ATL2, ATL23 may target defense-related proteins for degradation to regulate immune responses.

  • Potential interaction with receptor-like proteins: E3 ubiquitin ligases often regulate the stability of immune receptors. ATL23 might interact with receptor-like proteins (RLPs) or receptor-like kinases (RLKs) involved in pathogen recognition .

  • Hormonal crosstalk in defense: E3 ubiquitin ligases often mediate crosstalk between different hormone signaling pathways during defense responses .

How can transcriptional regulation of ATL23 be investigated?

To investigate the transcriptional regulation of ATL23, the following approaches are recommended:

  • Expression profiling under various conditions:

    • Quantitative RT-PCR to measure ATL23 expression in response to:

      • Pathogen infection

      • PAMPs (e.g., chitin, flagellin)

      • Plant hormones (SA, JA, ET, ABA)

      • Abiotic stresses

  • Promoter analysis:

    • Isolate the ATL23 promoter region (1-2 kb upstream of the start codon)

    • Generate promoter:reporter constructs (e.g., ATL23pro:GUS)

    • Transform Arabidopsis to assess tissue-specific expression patterns

    • Identify cis-regulatory elements through in silico analysis and deletion studies

  • Chromatin immunoprecipitation (ChIP):

    • Identify transcription factors that bind to the ATL23 promoter

    • Use transcription factor-specific antibodies for ChIP assays

    • Validate interactions using electrophoretic mobility shift assays (EMSA)

  • Co-expression network analysis:

    • Utilize the Arabidopsis eFP browser and other public databases to identify genes co-expressed with ATL23

    • This may provide clues about the biological pathways ATL23 is involved in

What methods are most effective for studying ATL23 localization and dynamics?

Based on successful approaches with similar proteins, these methods are recommended for studying ATL23 localization:

  • Confocal microscopy with fluorescent protein fusions:

    • Generate N- and C-terminal GFP/YFP fusions of ATL23

    • Express in Arabidopsis or transiently in Nicotiana benthamiana

    • Visualize subcellular localization using confocal microscopy

    • Use organelle-specific markers to confirm exact localization

  • Biochemical fractionation:

    • Isolate different cellular fractions (plasma membrane, cytosol, nucleus, etc.)

    • Detect ATL23 in each fraction using specific antibodies

    • Confirm purity of fractions using marker proteins

  • FRAP (Fluorescence Recovery After Photobleaching):

    • Assess protein dynamics and mobility within cellular compartments

    • Particularly useful if ATL23 is membrane-associated like ATL2

  • Protein dynamics during stress responses:

    • Monitor changes in localization following pathogen challenge or stress treatment

    • Assess protein stability and turnover under different conditions

How does ATL23 compare to other E3 ligases in terms of structure and function?

While specific information about ATL23 is limited in the search results, comparative analysis can be performed based on knowledge of the ATL family and other E3 ligases:

E3 Ligase TypeKey FeaturesStructural ElementsFunctionRelevance to ATL23
ATL family (RING-H2)Transmembrane domain, RING-H2 fingerN-terminal TM domain, central hydrophilic region, C-terminal RING-H2 domainPathogen defense, stress responsesATL23 likely shares these core features
HECT E3 ligasesForms thioester intermediate with ubiquitinN-terminal substrate binding domain, C-terminal HECT catalytic domainVarious cellular processesDifferent mechanism than ATL23
SCF complexesMulti-subunit E3 ligasesSKP1, CUL1, F-box, RBX1 componentsHormone signaling, cell cycleDifferent structure than ATL23
CUL3-BTB complexesMulti-subunit E3 ligasesCUL3, BTB/POZ domain protein, RBX1Various developmental processesDifferent structure than ATL23

What are promising future research directions for ATL23?

Based on current knowledge gaps and trends in plant E3 ligase research, these research directions appear most promising:

  • Substrate identification: Implementing proteomics approaches to identify ATL23 substrates would significantly advance understanding of its biological function.

  • Structural studies: Determining the three-dimensional structure of ATL23, particularly its RING-H2 domain, would provide insights into substrate recognition.

  • Genetic analysis: Generating and characterizing ATL23 knockout and overexpression lines to assess phenotypic effects on growth, development, and stress responses.

  • Interactome mapping: Comprehensive identification of ATL23 interacting partners using techniques like proximity labeling (BioID) combined with mass spectrometry.

  • Regulation mechanisms: Investigating how ATL23 itself is regulated at transcriptional, post-transcriptional, and post-translational levels.

  • Role in hormone signaling: Exploring potential roles in hormone signaling networks, as E3 ubiquitin ligases are key regulators of hormone signaling in plants .

  • Comparative studies with other ATL family members: Analyzing functional redundancy and specialization within the ATL family.

What statistical approaches are most appropriate for analyzing ATL23 experimental data?

For robust analysis of experimental data related to ATL23 research, these statistical approaches are recommended:

  • For expression optimization experiments:

    • Analysis of variance (ANOVA) to identify significant factors affecting expression

    • Response surface methodology (RSM) to model relationships between variables and optimize conditions

    • Principal component analysis (PCA) to reduce dimensionality of complex datasets

  • For interaction studies:

    • Statistical validation of mass spectrometry hits using criteria like Protein Lynx scores (>50 considered significant)

    • False discovery rate (FDR) control in large-scale interaction studies

    • Appropriate negative controls to filter out non-specific interactions

  • For phenotypic analysis:

    • Randomized complete block or completely randomized designs

    • Appropriate replication (minimum n=3 biological replicates)

    • Power analysis to determine required sample sizes

    • Non-parametric tests when data doesn't meet normality assumptions

  • For gene expression studies:

    • Normalization with appropriate reference genes

    • Statistical approaches for qRT-PCR data analysis (ΔΔCt method with statistical validation)

    • Multiple testing correction for transcriptome-wide studies

These approaches ensure rigorous experimental design and data analysis, leading to more reliable and reproducible results in ATL23 research .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.