Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase ATL31 (ATL31)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Arabidopsis thaliana E3 Ubiquitin-Protein Ligase ATL31 (ATL31)

Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase ATL31 (ATL31) is a protein derived from the model plant Arabidopsis thaliana. It plays a crucial role in regulating plant growth and responses to nutrient availability, particularly the balance between carbon and nitrogen (C/N) in the plant's environment. ATL31 is a RING-type E3 ubiquitin ligase, which means it is involved in the ubiquitination process, marking proteins for degradation by the proteasome. This process is essential for maintaining cellular homeostasis and responding to environmental changes.

Function and Role of ATL31

ATL31 is primarily involved in the regulation of the C/N response in Arabidopsis. It targets 14-3-3 proteins for ubiquitination, leading to their degradation via the ubiquitin-proteasome pathway. This degradation is crucial for modulating plant growth under varying C/N conditions. Overexpression of ATL31 enhances resistance to high C/low N stress, while its loss of function results in hypersensitivity during post-germinative growth .

Key Functions:

  • Regulation of C/N Response: ATL31 helps plants adapt to changes in carbon and nitrogen availability by modulating protein stability.

  • Ubiquitination of 14-3-3 Proteins: ATL31 specifically targets 14-3-3 proteins for degradation, influencing plant growth and stress responses.

  • Phosphorylation-Dependent Interaction: The interaction between ATL31 and 14-3-3 proteins is phosphorylation-dependent, highlighting the role of post-translational modifications in this process .

Recombinant ATL31 Protein Characteristics

The recombinant ATL31 protein is produced in E. coli and is available as a His-tagged protein. This recombinant form is useful for biochemical and biophysical studies aimed at understanding the protein's structure and function.

CharacteristicsDescription
SpeciesArabidopsis thaliana
SourceE. coli
TagN-terminal His tag
Protein LengthFull length (24-368 amino acids)
FormLyophilized powder
PurityGreater than 90% (SDS-PAGE)
StorageStore at -20°C/-80°C

Research Findings and Implications

Research on ATL31 has provided insights into its role in plant nutrient responses and stress tolerance. The protein's ability to target 14-3-3 proteins for degradation highlights the importance of the ubiquitin-proteasome system in regulating plant growth under varying environmental conditions.

Key Findings:

  • C/N Stress Response: ATL31's regulation of 14-3-3 proteins is crucial for plant adaptation to C/N stress conditions .

  • Phosphorylation and Interaction: Phosphorylation of ATL31 at specific sites enhances its interaction with 14-3-3 proteins, modulating their stability .

  • Plant Growth Regulation: ATL31's activity affects plant growth by influencing the abundance of key regulatory proteins like 14-3-3 .

References Sato et al. (2011). Identification of 14‐3‐3 proteins as a target of ATL31 ubiquitin ligase, a regulator of the C/N response in Arabidopsis. Yasuda et al. (2014). Phosphorylation of Arabidopsis ubiquitin ligase ATL31 is required for its interaction with 14-3-3 proteins. Creative Biomart. Recombinant Full Length Arabidopsis Thaliana E3 Ubiquitin-Protein Ligase Atl31(Atl31) Protein, His-Tagged. Sato et al. (2009). CNI1/ATL31, a RING-type ubiquitin ligase that functions in the carbon/nitrogen response for growth phase transition in Arabidopsis seedlings. Sato et al. (2011). Identification of 14‐3‐3 proteins as a target of ATL31 ubiquitin ligase, a regulator of the C/N response in Arabidopsis.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To request a specific tag, please specify this in your order; we will prioritize fulfilling such requests.
Synonyms
ATL31; CNI1; SSV1; At5g27420; F21A20.130; E3 ubiquitin-protein ligase ATL31; Protein CARBON/NITROGEN INSENSITIVE 1; Protein SUPER SURVIVAL 1; RING-H2 finger protein ATL31; RING-type E3 ubiquitin transferase ATL31
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-368
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ATL31
Target Protein Sequence
QPGTPDQRHDPYAYSGSLSPAMAVVVVVVIAALFFMGFFTVYIRHCTGAVDGSVTPAGGA RRRVTNATVARGLDAETIETFPTFVYSEVKTQKIGKGALECAICLNEFEDDETLRLLPKC DHVFHPHCIGAWLQGHVTCPVCRTNLAEQTPEPEVVVETDLEAQQQSAVPVPVVELPRVK FPRSHTTGHSVVLPGESTDRFTLRVPEELRKKIMANWKLNRSNSVFVLPRGGSSRSGKQV DRSRAKSDRWLFRKTPSFLWRNRDDGSIRLGGTGSVRGNSVTSPSGDSVRADRWAFLRNP SFLWRNTTPVPSPRVEVNNKDGEGTSSVQHIGTVGSTSGSLRLPV
Uniprot No.

Target Background

Function

Function: Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase ATL31 (ATL31) is an E3 ubiquitin-protein ligase essential for the plant's carbon/nitrogen (C/N) response during seedling growth transitions. It may also play a role in the early stages of plant defense signaling pathways.

Gene References Into Functions
References:
  1. Gain-of-function lines of VFP4 and ATL31 showed resistance to Agrobacterium tumorigenicity, suggesting that A. tumefaciens may utilize the host ubiquitin/proteasome system to destabilize transcriptional regulators involved in the host's disease response. PMID: 29264953
  2. Phosphorylation at 14-3-3 binding sites on ATL31 modulates the binding and stability of 14-3-3 proteins, thus regulating the plant's C/N nutrient response. PMID: 24722992
  3. ATL31 regulates senescence under disrupted CO2/N conditions. PMID: 24739470
  4. ATL31 targets and ubiquitinates 14-3-3 proteins for degradation via the ubiquitin-proteasome system in response to cellular C/N status. PMID: 21668537
  5. CNI1/ATL31 activity is necessary for the plant C/N response during seedling growth transitions. PMID: 19702666
Database Links

KEGG: ath:AT5G27420

STRING: 3702.AT5G27420.1

UniGene: At.30807

Protein Families
RING-type zinc finger family, ATL subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.