Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase ATL41 (ATL41)

Shipped with Ice Packs
In Stock

Description

Biological Role of ATL41 in Arabidopsis thaliana

ATL41 belongs to the ATL (Arabidopsis Tóxicos en Levadura) gene family, which encodes RING-H2-type E3 ligases involved in stress responses and developmental regulation. Key functions include:

  • Substrate Ubiquitination: Catalyzes the transfer of ubiquitin from E2 enzymes to target proteins, marking them for proteasomal degradation .

  • Stress Signaling: ATL-family proteins are induced by pathogens, UV-B irradiation, and hormonal cues, implicating ATL41 in stress adaptation .

  • Cell Cycle Regulation: Transcripts of related E3 ligases (e.g., AtSINAL7) peak during active cell division in floral tissues, suggesting roles in growth coordination .

Production and Purification Methodology

The recombinant protein is synthesized in E. coli, leveraging prokaryotic expression for high yield. Post-purification steps involve:

  1. Affinity Chromatography: His-tag binding to nickel or cobalt resins.

  2. Buffer Exchange: Stabilization in Tris/PBS with trehalose to prevent aggregation.

  3. Quality Control: SDS-PAGE and Western blotting to confirm purity and identity .

While E. coli systems are cost-effective, plant-based platforms (e.g., Arabidopsis super-expression systems) are emerging for complex eukaryotic proteins requiring post-translational modifications .

Mechanistic Studies

  • In Vitro Ubiquitination Assays: ATL41 demonstrates E3 ligase activity through self-ubiquitination, dependent on conserved lysine residues (e.g., Lys124 in AtSINAL7) .

  • Substrate Identification: Yeast two-hybrid screens and co-immunoprecipitation experiments are used to map interactomes .

Functional Insights

  • Circadian Regulation: Transcript levels of homologous E3 ligases (e.g., AtSINAL7) oscillate diurnally, linking ATL41 to circadian clock outputs .

  • UV-B Response: UV-B irradiation upregulates ATL-family transcripts, suggesting roles in DNA repair or photomorphogenesis .

Comparative Analysis of Plant E3 Ligases

E3 LigaseClassBiological RoleTarget Proteins
ATL41RING-H2Stress signaling, cell divisionUnknown
COP1RING-HCPhotomorphogenesisHY5, phyA
HOS1Incomplete RINGCold stress responseICE1
PRT1RINGN-end rule degradationAromatic-termini proteins

Data aggregated from studies on Arabidopsis E3 ligases .

Challenges and Future Directions

  • Substrate Specificity: ATL41’s endogenous targets remain unidentified, necessitating proteomic approaches like ubiquitome profiling.

  • Structural Insights: No crystallographic data exist for ATL41; homology modeling using RING-H2 templates (e.g., PCAF_N) could elucidate binding interfaces .

  • Biotechnological Applications: Engineering ATL41 for targeted protein degradation (e.g., PROTACs) in crop improvement or synthetic biology .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ATL41; At2g42360; MHK10.8; E3 ubiquitin-protein ligase ATL41; RING-H2 finger protein ATL41; RING-type E3 ubiquitin transferase ATL41
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-236
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ATL41
Target Protein Sequence
MSSNDRDHRRFNSDHHSFWPNPSTYDLNSKIMLAAVASLSGVILIVFALHLYARFVLRRR REAFRGLPVIFRHPFEMPKRGLNPTVIASLPTFTVGATDGVAASATECAVCLSVLKEQDK ARELPNCKHIFHVDCVDTWLTTCSTCPVCRTEVEPRPRLEPEPREGPVGTAPQLLVETRL NLTVEAASSSSSDNKTVVSPASRLNSFRKILTRERSSNRINHSCPDQDRVADLERH
Uniprot No.

Target Background

Function
E3 ubiquitin-protein ligase; catalyzes polyubiquitination with ubiquitin-conjugating enzymes E2 UBC8, UBC10, UBC11, UBC28, UBC29, UBC30, UBC35, and UBC36 *in vitro*.
Database Links

KEGG: ath:AT2G42360

STRING: 3702.AT2G42360.1

UniGene: At.67220

Protein Families
RING-type zinc finger family, ATL subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the molecular structure of ATL41 and how does it compare to other E3 ubiquitin ligases in Arabidopsis thaliana?

ATL41 belongs to the RING-type E3 ubiquitin ligase family in Arabidopsis thaliana, characterized by a specific C3HC4-type RING finger domain that coordinates zinc ions. Unlike HECT-type E3 ligases that form a covalent intermediate with ubiquitin, ATL41 functions as a molecular adapter between E2 enzymes and target proteins. The RING domain facilitates the direct transfer of ubiquitin from E2 to substrate proteins. ATL41 is one of more than 1000 E3 ubiquitin ligases encoded in the Arabidopsis genome, highlighting the specificity and complexity of the ubiquitination system in plants .

How does ATL41 fit into the broader context of protein ubiquitination in plants?

ATL41 functions within the three-step ubiquitination cascade essential for protein degradation in plants. This process begins with ubiquitin activation by an E1 enzyme, followed by transfer to an E2 conjugating enzyme, and finally, ATL41 as an E3 ligase catalyzes the transfer of ubiquitin to specific target proteins. This process marks these proteins for degradation by the 26S proteasome system. E3 ligases like ATL41 are responsible for substrate specificity in this pathway, recognizing particular target proteins for ubiquitination. The ubiquitin-proteasome system regulates numerous biological processes in plants, including hormone signaling, development, and responses to environmental stresses .

What are the known biological functions of ATL41 in Arabidopsis thaliana development and stress responses?

ATL41, like other E3 ubiquitin ligases in Arabidopsis, likely plays roles in multiple cellular processes including hormonal control of vegetative growth, plant reproduction, light response, and stress tolerance. While specific functions of ATL41 are still being elucidated, research on related E3 ligases suggests it may exhibit circadian expression patterns and respond to environmental stimuli such as UV-B radiation, similar to AtSINAL7 . The expression patterns of ATL41 in different tissues and developmental stages provide crucial insights into its potential functions in plant growth regulation and environmental adaptation .

What are the most effective methods for recombinant expression and purification of ATL41?

Recommended Expression Systems:

Expression SystemAdvantagesLimitationsOptimal Conditions
E. coli BL21(DE3)High yield, economical, rapid growthPotential improper folding, lack of post-translational modificationsInduction: 0.5 mM IPTG, 18°C, 16-20 hours
Insect cells (Sf9)Better folding, post-translational modificationsHigher cost, longer production timeInfection multiplicity: MOI 2-5, harvest at 72 hours
Plant-based expressionNative modifications, proper foldingLower yields, time-consumingAgroinfiltration in N. benthamiana, harvest 3-5 days post-infiltration

For purification of functional ATL41, a multi-step approach is recommended: (1) Affinity chromatography using His-tag or GST-tag; (2) Size exclusion chromatography to remove aggregates; (3) Ion exchange chromatography for final polishing. Critical buffer considerations include maintaining 10% glycerol, 1-5 mM DTT to preserve the RING domain structure, and zinc supplementation (10-50 μM ZnCl₂) to ensure proper folding of the zinc finger domain. Success of purification should be verified through SDS-PAGE, Western blotting, and activity assays testing self-ubiquitination capacity .

What assays can be used to accurately measure ATL41 E3 ligase activity in vitro?

Key Assays for ATL41 Activity Assessment:

  • Self-ubiquitination assay: The most direct method involves incubating purified ATL41 with E1, E2 (preferably from the UBC8 family), ATP, and ubiquitin, followed by detection of poly-ubiquitin chains via Western blotting. Similar to AtSINAL7, ATL41 activity would depend on specific lysine residues within its structure .

  • Substrate-specific ubiquitination assay: When potential substrates are identified, this assay monitors the transfer of ubiquitin to the substrate protein over time. Measurements can be taken using:

    • Western blot analysis with anti-ubiquitin antibodies

    • Fluorescence-based assays using labeled ubiquitin

    • Mass spectrometry to identify specific ubiquitination sites

  • E2 discharge assay: Measures the ability of ATL41 to stimulate the discharge of ubiquitin from a charged E2 enzyme, providing insights into the initial catalytic step.

Critical controls should include catalytically inactive mutants (typically mutations in the RING domain), omission of ATP, and use of ubiquitin mutants lacking specific lysine residues to determine chain linkage preferences .

How can I identify and validate physiological substrates of ATL41?

Identifying the specific substrates of ATL41 requires a multi-faceted approach:

  • Yeast two-hybrid screening: Use ATL41 as bait to screen an Arabidopsis cDNA library, focusing on interactions that depend on the substrate-binding domain but not the RING domain.

  • Co-immunoprecipitation coupled with mass spectrometry: Express tagged versions of ATL41 in Arabidopsis, stabilize interactions using proteasome inhibitors, and identify co-precipitating proteins.

  • Protein arrays: Overlay purified ATL41 on Arabidopsis protein arrays to identify direct binding partners.

  • Quantitative proteomics: Compare protein abundance in wild-type vs. ATL41 knockout/overexpression lines using methods like SILAC or TMT labeling.

Validation of potential substrates should include:

  • Confirmation of direct interaction

  • In vitro ubiquitination assays with the purified substrate

  • Demonstration of altered substrate stability in plants with modified ATL41 expression

  • Identification of ubiquitination sites on the substrate via mass spectrometry

  • Genetic epistasis analysis to confirm the physiological relevance of the interaction

How does the specificity of ATL41 for its E2 partners and substrates compare with other ATL family members?

The specificity of E3 ubiquitin ligases for their E2 partners is crucial for determining ubiquitination patterns and substrate fate. For ATL41, this specificity likely involves:

  • E2 partner selection: ATL41 may preferentially interact with specific E2 enzymes, potentially from the UBC8 family as observed with other plant E3 ligases such as UPL1 . This selectivity may be determined by specific amino acid residues within the RING domain that create an optimal interface with the E2. Comparative analysis with other ATL family members would require:

    • In vitro binding assays with different E2 enzymes

    • Activity assays testing various E2-ATL41 combinations

    • Structural analysis of interaction interfaces

  • Substrate recognition mechanisms: Unlike the F-box or BTB-containing E3 ligases that function in multi-subunit complexes, ATL41 as a RING-type E3 likely recognizes substrates directly. The specificity determinants may include:

    • Specific amino acid sequences (degrons) in substrates

    • Post-translational modifications that trigger recognition

    • Conformational changes in either ATL41 or substrates

Comparative studies with other ATL family members would reveal whether they target overlapping or distinct substrate pools, providing insights into functional redundancy or specialization within this family .

What is the role of ATL41 in circadian rhythm regulation and how is it affected by light conditions?

Based on observations of circadian expression patterns in related E3 ligases like AtSINAL7 , ATL41 may exhibit similar temporal regulation:

  • Expression analysis under different light conditions:

    • ATL41 transcript levels likely follow diurnal patterns with specific peaks and troughs over a 24-hour cycle

    • Quantitative RT-PCR data collected at 3-hour intervals would reveal these patterns

    • Expression may differ between continuous light, continuous dark, and normal day/night cycles

  • Light-responsive elements in the ATL41 promoter:

    • Bioinformatic analysis may reveal cis-regulatory elements associated with light responsiveness

    • These elements could bind transcription factors involved in light signaling pathways

  • Physiological significance:

    • ATL41 may target clock components for degradation at specific times of day

    • This degradation would contribute to the rhythmic oscillation of clock proteins

    • Genetic studies involving ATL41 knockout/overexpression lines would show altered circadian phenotypes

The potential UV-B responsiveness of ATL41, similar to AtSINAL7 , suggests it may participate in light stress responses, potentially targeting damaged proteins for degradation or regulating stress signaling components .

How does post-translational modification of ATL41 affect its activity and substrate specificity?

E3 ubiquitin ligases themselves are often regulated by post-translational modifications (PTMs), creating an additional layer of control. For ATL41, several potential regulatory mechanisms should be investigated:

  • Phosphorylation:

    • Prediction algorithms identify several potential phosphorylation sites in ATL41

    • Phosphorylation could alter substrate binding affinity or E2 interaction

    • Mass spectrometry analysis of ATL41 isolated from plants under different conditions would reveal phosphorylation patterns

    • Targeted mutagenesis of phosphorylation sites would determine their functional significance

  • Auto-ubiquitination:

    • Like many E3 ligases, ATL41 likely undergoes self-ubiquitination

    • This process may serve as a feedback mechanism controlling ATL41 abundance

    • The specific lysine residue(s) involved (similar to K124 in AtSINAL7 ) would be critical for this activity

    • Auto-ubiquitination could be competitive with substrate ubiquitination, creating a regulatory mechanism

  • Other potential modifications:

    • SUMOylation may compete with ubiquitination at specific lysine residues

    • S-nitrosylation of cysteine residues in the RING domain could affect zinc coordination

    • Redox-dependent modifications might link ATL41 activity to cellular stress levels

A comprehensive analysis of these modifications would provide insights into how ATL41 activity is dynamically regulated in response to developmental and environmental signals .

How can I analyze ATL41 expression data across different tissues and stress conditions?

When analyzing ATL41 expression data, consider these methodological approaches:

  • Normalization strategies for accurate comparison:

    • Use multiple reference genes (e.g., ACT2, UBQ10, EF1α) for RT-qPCR normalization

    • For RNA-seq data, TPM or FPKM values allow cross-sample comparisons

    • Apply appropriate statistical tests (ANOVA followed by post-hoc tests) for multi-condition comparisons

  • Temporal expression analysis:

    • Plot expression across developmental stages and circadian time points

    • Use autocorrelation analysis to identify periodicity in expression patterns

    • Compare with known circadian markers to establish phase relationships

  • Spatial expression analysis:

    • Tissue-specific expression may reveal functions in particular developmental contexts

    • Cell-type-specific expression data provides higher resolution insights

    • Promoter-reporter fusions can validate expression patterns identified in transcriptomic data

  • Stress-responsive expression:

    • Calculate fold changes and statistical significance for each stress condition

    • Cluster analysis can identify co-regulated genes that may function in the same pathway

    • Comparison with stress-responsive transcription factor binding sites in the ATL41 promoter can reveal regulatory mechanisms

Example Data Table: ATL41 Expression Across Tissues and Conditions

Tissue/ConditionRelative Expression (normalized to ACT2)Statistical SignificanceCo-expressed Genes
Root1.0 ± 0.2ReferenceUBC8, CUL1, SKP1
Leaf2.3 ± 0.3p < 0.01RBX1, COP1, HY5
Flower bud4.7 ± 0.5p < 0.001FLC, LFY, AP1
UV-B (2h)3.8 ± 0.4p < 0.001UVR8, HY5, CHS
Drought (24h)1.2 ± 0.3Not significant-
Cold (4°C, 12h)2.8 ± 0.3p < 0.01CBF1, COR15A

This data would indicate tissue-specific functions prioritized in reproductive tissues and involvement in UV-B and cold stress responses but not drought response .

What statistical approaches are most appropriate for analyzing ubiquitination assay data for ATL41?

Ubiquitination assays generate complex data that require specialized statistical approaches:

  • Quantification of ubiquitination signals:

    • Densitometry analysis of Western blots should include multiple exposures to ensure linearity

    • For fluorescence-based assays, standard curves with known amounts of ubiquitinated standards are essential

    • Background subtraction should account for non-specific antibody binding

  • Time-course analysis:

    • Fit ubiquitination kinetics to appropriate mathematical models (e.g., Michaelis-Menten for initial velocity)

    • Calculate key parameters: Vmax, Km, kcat for comparing wild-type vs. mutant ATL41

    • Use non-linear regression rather than linearization methods for more accurate parameter estimation

  • Comparative analysis across conditions:

    • Two-way ANOVA can assess the effects of multiple variables (e.g., E2 type and substrate)

    • Post-hoc tests with appropriate corrections for multiple comparisons (e.g., Tukey's HSD)

    • For non-normally distributed data, non-parametric alternatives like Kruskal-Wallis should be used

  • Controls and validations:

    • Include technical replicates (minimum n=3) and biological replicates (minimum n=3)

    • Positive controls (known active E3 ligase) and negative controls (catalytically inactive mutant)

    • Statistical power analysis to determine appropriate sample sizes

Example Data Analysis Workflow:

For comparing ATL41 activity with different E2 enzymes:

  • Measure ubiquitination signal intensity at multiple time points

  • Calculate initial reaction velocities for each E2-ATL41 combination

  • Perform one-way ANOVA followed by Tukey's HSD test

  • Report means, standard deviations, p-values, and effect sizes

  • Visualize using box plots with individual data points visible

How can I interpret contradictory data on ATL41 function from different experimental approaches?

When faced with contradictory data regarding ATL41 function, a systematic analytical approach is essential:

  • Source of contradiction analysis:

    • Methodological differences: In vitro vs. in vivo approaches may yield different results due to cellular context

    • Genetic background effects: ATL41 function may differ across ecotypes or mutant backgrounds

    • Environmental conditions: Growth conditions may significantly impact experimental outcomes

    • Redundancy: Other E3 ligases may compensate for ATL41 in knockout studies

  • Resolution strategies:

    • Orthogonal validation: Confirm findings using independent techniques (e.g., genetic, biochemical, and imaging approaches)

    • Dose-dependency: Test ATL41 function across a range of expression levels

    • Temporal analysis: Consider developmental timing and circadian effects

    • Spatial resolution: Cell-type-specific studies may resolve tissue-level contradictions

  • Integration framework:

    • Construct hypothetical models that incorporate seemingly contradictory data

    • Test predictions of these models with targeted experiments

    • Consider context-dependent functions of ATL41 in different conditions or tissues

    • Evaluate the possibility of bifunctional or moonlighting activities beyond canonical E3 ligase function

  • Technical considerations:

    • Antibody specificity: Validate antibodies against ATL41 knockout controls

    • Tag interference: Different tags (FLAG, GFP, etc.) may affect protein function differently

    • Expression artifacts: Overexpression may cause non-physiological interactions or localization

The contradictory data may ultimately reveal context-specific functions of ATL41, similar to how other E3 ligases show condition-dependent activities across diverse biological processes .

Why might recombinant ATL41 show poor solubility or activity, and how can these issues be addressed?

Recombinant E3 ubiquitin ligases like ATL41 often present challenges in expression and activity. The following issues and solutions should be considered:

  • Poor solubility issues:

    • The RING domain of ATL41 contains zinc-coordinating cysteine and histidine residues that are prone to oxidation, potentially causing aggregation

    • Hydrophobic regions may promote non-specific interactions

    Solutions:

    • Express at lower temperatures (16-18°C) to slow folding and prevent aggregation

    • Include 5-10% glycerol and 1-5 mM reducing agents (DTT or TCEP) in all buffers

    • Supplement expression media and purification buffers with 10-50 μM ZnCl₂

    • Consider fusion tags that enhance solubility (MBP, SUMO, or TrxA) rather than just affinity tags

    • Test multiple constructs with different domain boundaries to identify stable variants

  • Low activity issues:

    • Loss of structural zinc during purification may compromise the RING domain structure

    • Oxidation of critical cysteine residues in the RING domain

    • Improper folding or post-translational modifications

    Solutions:

    • Verify correct folding using circular dichroism or thermal shift assays

    • Test multiple E2 enzymes as partners (particularly from the UBC8 family)

    • Include zinc regeneration step in the purification protocol

    • Verify structural integrity with limited proteolysis

    • For in vitro assays, optimize buffer conditions (pH 7.5-8.0, 150-300 mM NaCl)

  • Storage and stability:

    • Flash-freeze small aliquots in liquid nitrogen and store at -80°C

    • Avoid repeated freeze-thaw cycles

    • Test activity immediately after purification and again after storage to assess stability

    • Consider adding protein stabilizers such as trehalose or arginine to storage buffers

What are the most common pitfalls in generating and analyzing ATL41 mutants in Arabidopsis?

Creating and characterizing ATL41 mutants presents several technical challenges:

  • Gene editing challenges:

    • Potential off-target effects with CRISPR/Cas9 approaches

    • Functional redundancy with other ATL family members may mask phenotypes

    • Lethality if ATL41 has essential functions

    Solutions:

    • Design multiple guide RNAs and thoroughly sequence edited lines

    • Generate conditional knockouts using inducible systems

    • Create higher-order mutants with related ATL genes to address redundancy

    • Use tissue-specific or inducible promoters for essential genes

  • Phenotypic analysis challenges:

    • Subtle phenotypes may be missed in standard growth conditions

    • Environmental conditions may significantly affect mutant phenotypes

    • Developmental timing of phenotypes may be critical

    Solutions:

    • Test multiple growth conditions, particularly stress conditions

    • Perform detailed time-course analyses of development

    • Use quantitative phenotyping approaches (growth rate, photosynthetic efficiency)

    • Examine cellular-level phenotypes using appropriate microscopy techniques

  • Complementation and overexpression issues:

    • Ectopic expression may cause artifactual phenotypes

    • Tag interference with protein function

    • Position effects in transgenic lines

    Solutions:

    • Use native promoter and terminator for complementation

    • Create multiple independent transgenic lines

    • Test both N- and C-terminal tags to minimize functional interference

    • Verify expression levels with qRT-PCR and protein levels with Western blotting

  • Data interpretation challenges:

    • Distinguishing direct vs. indirect effects of ATL41 mutation

    • Separating developmental from physiological phenotypes

    • Accounting for natural variation in Arabidopsis responses

    Solutions:

    • Include appropriate controls for all experiments

    • Use time-resolved analyses to determine sequence of events

    • Test multiple ecotypes for consistent phenotypes

    • Combine genetic and biochemical approaches for validation

How can I overcome challenges in identifying the specific ubiquitination sites on ATL41 substrates?

Identifying specific ubiquitination sites represents one of the most significant challenges in E3 ligase research:

  • Technical challenges in site identification:

    • Low abundance of ubiquitinated forms in vivo

    • Ubiquitination is often transient due to rapid proteasomal degradation

    • Multiple potential lysine residues on substrates

    • Branch points in ubiquitin chains complicate mass spectrometry analysis

    Advanced methodological solutions:

    • Use proteasome inhibitors (MG132) to stabilize ubiquitinated proteins

    • Employ tandem ubiquitin binding entities (TUBEs) for enrichment

    • Utilize ubiquitin remnant antibodies that recognize the di-glycine signature

    • Apply parallel reaction monitoring (PRM) for targeted MS analysis

    • Consider AQUA peptides as internal standards for quantification

  • Validation of identified sites:

    • Generate lysine-to-arginine mutants of candidate sites

    • Perform in vitro ubiquitination assays with wild-type and mutant substrates

    • Express mutants in planta and assess protein stability

    • Use proximity ligation assays to confirm ATL41-substrate interactions in vivo

  • Differentiating ATL41-specific sites from those targeted by other E3 ligases:

    • Compare ubiquitinomes of wild-type and ATL41 mutant plants

    • Use structural analysis or molecular modeling to predict ATL41-substrate interfaces

    • Perform competition assays with related E3 ligases

  • Determining ubiquitin chain topology:

    • Use ubiquitin mutants with single lysines available (K48 only, K63 only, etc.)

    • Apply linkage-specific antibodies in Western blot analysis

    • Utilize specialized mass spectrometry approaches for linkage analysis

    • Correlate chain topology with substrate fate (degradation vs. signaling)

Example Workflow:

  • In vitro ubiquitination of purified substrate with ATL41

  • Tryptic digestion followed by enrichment of ubiquitinated peptides

  • LC-MS/MS analysis with emphasis on identifying di-glycine remnants

  • Parallel analysis of samples from wild-type and ATL41 knockout plants

  • Confirmation of sites through mutagenesis and functional assays

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.