Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase ATL4 (ATL4)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Arabidopsis thaliana E3 Ubiquitin-Protein Ligase ATL4 (ATL4)

E3 ubiquitin ligases, such as Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase ATL4 (ATL4), play a crucial role in the ubiquitin-proteasome system (UPS) . The UPS is a highly regulated enzymatic cascade that involves E1, E2, and E3 enzymes . The E3 ubiquitin ligase is responsible for substrate recognition and facilitating the transfer of ubiquitin from E2 to a substrate protein, marking it for degradation or altering its function . The Arabidopsis thaliana genome encodes a large number of putative E3 ubiquitin ligases, allowing for a flexible response to environmental changes and stresses .

Functional Mechanisms

The ubiquitination process is essential for various cellular processes. It involves a three-step enzymatic cascade :

  1. Activation of ubiquitin by an E1 activating enzyme.

  2. Transfer of ubiquitin to an E2 conjugating enzyme.

  3. Substrate recognition and ubiquitin transfer to the target protein, mediated by an E3 ubiquitin ligase .

E3 ubiquitin ligases confer substrate specificity in the ubiquitination pathway . They can be classified into different groups based on specific domains, with the HECT, U-box, and RING families being the most important . For example, ATL31, a RING-type ubiquitin ligase, targets 14-3-3 proteins for degradation via the ubiquitin-proteasome system during the response to cellular carbon/nitrogen status .

Classes of E3 Ubiquitin Ligases

E3 ubiquitin ligases are classified into different groups based on the presence of specific domains, with the RING finger domain being the most common .

  • RING-type E3 ligases The RING-finger domain is the most abundant class in plants .

  • HECT-type E3 ligases HECT-type E3 ligases are characterized by a conserved C-terminal domain that binds to ubiquitin.

  • U-box E3 ligases U-box E3 ligases are similar to RING-finger E3 ligases but lack the conserved zinc-binding motifs.

  • Other E3 ligases Other E3 ligases contain a variety of domains, such as F-box, BTB, and Skp1 domains.

Biological Processes and Interactions

E3 ubiquitin ligases are involved in the regulation of numerous biological processes, including hormonal control of vegetative growth and plant responses to biotic and abiotic stresses .

Table 1: Examples of E3 Ubiquitin Ligases and Their Functions in Arabidopsis thaliana

E3 Ubiquitin LigaseE3 TypeBiological Processes
TIR1F-boxAuxin receptor
COP1RING-HCaPhotomorphogenesis
EBF1/2F-boxEthylene signaling
NPR1BTBSalicylic and jasmonic acid response
CHIPU-BOXTemperature stress
SLY1/SNEF-boxGA signaling

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag, please specify it; we will prioritize its use.
Synonyms
ATL4; RHX1A; At3g60220; F27H5_10; E3 ubiquitin-protein ligase ATL4; Protein ARABIDOPSIS TOXICOS EN LEVADURA 4; Protein ATL4; RING-H2 finger X1a; RING-H2 zinc finger protein ATL4; RING-H2 zinc finger protein RHX1a; RING-type E3 ubiquitin transferase ATL4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-334
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ATL4
Target Protein Sequence
MESLINPSHGGGNYDSHSSSLDSLKPSVLVIILILLMTLLISVSICFLLRCLNRCSHRSV LPLSSSSSVATVTSDSRRFSGHRVSPETERSSVLDSLPIFKFSSVTRRSSSMNSGDCAVC LSKFEPEDQLRLLPLCCHAFHADCIDIWLVSNQTCPLCRSPLFASESDLMKSLAVVGSNN GGGENSFRLEIGSISRRRQTPIPESVEQHRTYSIGSFDYIVDDVDSEISESNFNRGKQED ATTTTATATAVTTNPTSFEASLAADIGNDGSRSWLKDYVDRLSRGISSRAMSFRSSGRFF TGSSRRSEELTVMDLEANHAGEEISELFRWLSGV
Uniprot No.

Target Background

Function
E3 ubiquitin-protein ligase; catalyzes polyubiquitination with ubiquitin-conjugating enzyme E2 UBC8 in vitro.
Database Links

KEGG: ath:AT3G60220

STRING: 3702.AT3G60220.1

UniGene: At.21814

Protein Families
RING-type zinc finger family, ATL subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.