Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase ATL59 (ATL59)

Shipped with Ice Packs
In Stock

Description

Introduction

Ubiquitination is a crucial post-translational modification process that regulates protein turnover, signal transduction, and various cellular functions in plants . This process involves the sequential action of three enzymes: E1 (ubiquitin-activating enzyme), E2 (ubiquitin-conjugating enzyme), and E3 (ubiquitin ligase) . E3 ubiquitin ligases confer specificity to the ubiquitination process by recognizing and binding to specific substrate proteins, facilitating the transfer of ubiquitin from the E2 enzyme to the target protein .

Among the E3 ubiquitin ligases found in Arabidopsis thaliana, the RING-type E3 ubiquitin-protein ligase ATL59 is a member of the ATL (Arabidopsis Tóxicos en Levadura) family . The ATL family is characterized by a RING-H2 domain with a specific signature motif .

E3 Ubiquitin Ligase Activity

ATL59 functions as an E3 ubiquitin-protein ligase, capable of catalyzing polyubiquitination in vitro . It interacts with ubiquitin-conjugating enzymes E2 such as UBC8, UBC10, UBC11, and UBC34 .

Genomic Organization and Identification

Functional genomic studies have indicated that approximately 5% of the Arabidopsis genome encodes proteins involved in the ubiquitination pathway . Kosarev et al. identified 365 genes, grouped into six clusters based on sequence similarity and RING domain features . Stone et al. performed a more extensive search, leading to the identification of 469 genes characterized by three RING-type (RING-H2, RING-Hca, and RING-HCb) and five modified RING-type domains . Serrano et al. identified 80 ATL proteins in Arabidopsis, with most of them clustered together .

Involvement in Plant Development and Stress Response

E3 ubiquitin ligases play a crucial role in plant development and stress response . For instance, the Arabidopsis thaliana E3 ubiquitin ligase BRIZ participates in abscisic acid (ABA) signaling or response . Loss of function of the E3 DESPIERTO results in decreased ABI3 and ABI4 expression during seed development, reduced ABA sensitivity during germination, and loss of dormancy .

Availability and Resources

Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase ATL59 is available for purchase from commercial sources for life science research . These recombinant proteins are produced in various expression systems, including Yeast, E. coli, Baculovirus, and Mammalian cells .

Key Features of E3 Ubiquitin Ligases

FeatureDescription
SpecificityE3 ligases provide specificity to the ubiquitination process by recognizing and binding to specific substrate proteins .
RegulationThe presence and activity of E3s are important points of regulation in the ubiquitin system .
Domain AssociationsRING motifs in E3 ligases are often associated with other domains that may interact with the target protein or act as regulatory components . These domains include coiled-coil motifs, zinc finger motifs, and Ankyrin repeats .
Role in ABA SignalingSome E3 ubiquitin ligases, like BRIZ, function in abscisic acid (ABA) signaling or response . Mutants lacking functional BRIZ proteins exhibit altered germination and seedling development, indicating the importance of E3 ligases in ABA-mediated processes .
PhotomorphogenesisThe RING finger E3 ubiquitin ligase COP1 functions as a central switch in light control of Arabidopsis seedling development . COP1 interacts with proteins like COP10 and CIP8, and its C-terminal WD40 repeats are involved in the recognition of ubiquitination targets .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. To specify a tag type, please inform us, and we will prioritize its inclusion.
Synonyms
ATL59; At4g10160; F28M11.80; T9A4.20; E3 ubiquitin-protein ligase ATL59; RING-H2 finger protein ATL59; RING-type E3 ubiquitin transferase ATL59
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ATL59
Target Protein Sequence
MSFIDPRTYIPSNSTESQILKFTFIVCVPICVILIVLLVLYIMRRNSNTNVDWSSLGGFV PTNNNLSTAELGLSKDIREMLPIVIYKESFTVNDTQCSVCLGDYQAEEKLQQMPSCGHTF HMECIDLWLTSHTTCPLCRLSLIPKPSVDLSHQSIEIVSSIENTNGGEASTQPDSQSATE AIIHIDDVEEGNRDSIEVVKESEENDRNSVGTSDGCCSCRLGEKA
Uniprot No.

Target Background

Function

Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase ATL59 (ATL59) is an E3 ubiquitin-protein ligase capable of catalyzing polyubiquitination in vitro with ubiquitin-conjugating enzymes E2 UBC8, UBC10, UBC11, and UBC34.

Database Links

KEGG: ath:AT4G10160

STRING: 3702.AT4G10160.1

UniGene: At.33649

Protein Families
RING-type zinc finger family, ATL subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the function of E3 ubiquitin-protein ligase ATL59 in Arabidopsis thaliana?

E3 ubiquitin-protein ligase ATL59 belongs to the ATL family of RING-type E3 ubiquitin ligases in Arabidopsis thaliana, which are involved in protein degradation via the ubiquitin-proteasome system. Like other members of the ATL family, such as ATL9, ATL59 likely plays a role in plant stress responses through targeted protein degradation. Research on related ATL proteins shows they are often involved in plant immune responses and stress adaptation mechanisms . Experimental evidence suggests these proteins are short-lived and undergo post-translational regulation, which is critical for their proper function in plant defense mechanisms .

How is ATL59 expression regulated in Arabidopsis?

Like other ATL family members, ATL59 expression is likely regulated at both transcriptional and post-translational levels. Transcriptional regulation may occur in response to various stressors, similar to how ATL9 is regulated. Post-translationally, ATL proteins are typically short-lived and undergo rapid turnover. This has been demonstrated with related ATL proteins through GUS staining experiments that show minimal protein accumulation despite active transcription, suggesting tight post-translational control . The regulation may involve specific proteasomal degradation pathways that control protein half-life in response to external stimuli or developmental cues.

What methodologies are commonly used to study ATL59 expression?

Several molecular biology techniques are employed to study ATL family proteins like ATL59:

  • Promoter-GUS fusion assays: These determine tissue-specific expression patterns by fusing the promoter region to a GUS reporter gene .

  • Protein-GFP fusion constructs: Used to visualize subcellular localization and protein stability in plant cells.

  • Recombinant DNA procedures: Including cloning of the gene with its regulatory regions using specific primers with attB recombination sites for Gateway cloning systems .

  • Transient expression systems: Using onion epidermal cells or tobacco for studying post-translational regulation .

  • RT-PCR and qPCR: For analyzing transcript levels under various conditions.

These methods allow researchers to comprehensively investigate expression patterns, regulation mechanisms, and functional roles of ATL proteins in plant biology.

How do the structural features of ATL59 relate to its function in the ubiquitination pathway?

ATL59, like other ATL family members, contains characteristic structural domains that determine its function in ubiquitination pathways. The protein likely contains:

  • An N-terminal transmembrane domain: This anchors the protein to cellular membranes, similar to what has been observed in ATL9 .

  • A RING-H2 finger domain: This zinc-finger domain is essential for E3 ligase activity, facilitating the transfer of ubiquitin from E2 conjugating enzymes to target substrates.

  • Variable regions: These may confer specificity for particular substrates or regulatory proteins.

Experimental approaches to study structure-function relationships include:

  • Creating deletion mutants (e.g., ΔTM variants removing transmembrane domains)

  • Site-directed mutagenesis of critical residues in the RING domain

  • Co-immunoprecipitation studies to identify interacting proteins

  • In vitro ubiquitination assays to assess enzymatic activity

The integrity of these domains is crucial for proper function, as demonstrated in studies with related ATL proteins where domain deletions significantly affect protein function and localization.

What are the challenges in expressing recombinant ATL59 for biochemical studies?

Expressing recombinant ATL59 presents several challenges that researchers must address:

  • Protein instability: ATL family proteins like ATL9 are typically short-lived , making accumulation of sufficient protein for biochemical studies difficult.

  • Transmembrane domain complications: The presence of transmembrane domains can cause aggregation or misfolding when expressed in heterologous systems.

  • Post-translational modifications: Ensuring proper post-translational modifications, which may be critical for function, can be challenging in non-plant expression systems.

  • Maintaining enzymatic activity: Preserving E3 ligase activity during purification requires careful buffer optimization and handling.

Researchers typically address these challenges through:

  • Using plant-based expression systems rather than bacterial systems

  • Creating fusion proteins with solubility-enhancing tags

  • Developing truncated versions that maintain catalytic activity without problematic domains

  • Employing proteasome inhibitors during extraction to prevent degradation

  • Optimizing purification conditions to maintain native conformation and activity

How do environmental stressors modulate ATL59 activity in Arabidopsis thaliana?

Environmental stressors likely affect ATL59 activity through multiple mechanisms, similar to other ATL family proteins:

  • Transcriptional upregulation: Studies with related ATL proteins show increased transcription in response to specific stressors. For example, aluminum stress induces expression of several stress-responsive genes in Arabidopsis, including those involved in the ubiquitin pathway .

  • Post-translational modifications: Phosphorylation or other modifications may alter protein stability or activity in response to stress signals.

  • Substrate availability: Stress conditions may increase the abundance of target proteins requiring ubiquitination.

  • Subcellular relocalization: Environmental cues might trigger changes in protein localization, affecting access to substrates.

Research approaches to study these effects include:

  • Transcriptomic analysis under various stress conditions

  • Protein stability assays with and without stress treatments

  • Proteomic identification of stress-induced post-translational modifications

  • Identification of stress-specific substrates through co-immunoprecipitation followed by mass spectrometry

These approaches help elucidate how ATL59 contributes to stress adaptation mechanisms in plants.

What are the optimal conditions for expressing recombinant ATL59 in heterologous systems?

Based on experiences with related E3 ubiquitin ligases, the optimal conditions for expressing recombinant ATL59 include:

  • Expression system selection:

    • Plant-based systems like Nicotiana benthamiana for maintaining native folding and post-translational modifications

    • Saccharomyces cerevisiae for eukaryotic expression with reasonable yield

    • E. coli expression systems (e.g., BL21(DE3)) for high yield, though functionality may be compromised

  • Expression construct design:

    • Include affinity tags (His6, GST, or MBP) for purification

    • Consider removing transmembrane domains (ATL59ΔTM) to improve solubility

    • Optimize codon usage for the selected expression host

  • Induction and growth conditions:

    • For bacterial systems: Lower temperatures (16-20°C) to reduce inclusion body formation

    • For yeast and plant systems: Optimize expression time to balance yield with protein degradation

  • Extraction and purification:

    • Include proteasome inhibitors to prevent degradation

    • Use mild detergents for membrane-bound versions

    • Perform purification steps quickly at 4°C to minimize degradation

These conditions should be optimized specifically for ATL59 through small-scale expression trials before proceeding to large-scale production.

How can researchers identify physiological substrates of ATL59?

Identifying the physiological substrates of ATL59 requires a multi-faceted approach:

  • Yeast two-hybrid screening:

    • Use ATL59 as bait to screen Arabidopsis cDNA libraries

    • Focus on the substrate-binding region, excluding transmembrane domains

  • Co-immunoprecipitation coupled with mass spectrometry:

    • Express tagged versions of ATL59 in Arabidopsis

    • Perform pull-downs under different conditions to capture transient interactions

    • Use proteasome inhibitors to stabilize substrate interactions

  • Ubiquitination assays:

    • In vitro ubiquitination assays with candidate substrates

    • In vivo ubiquitination assays using appropriate antibodies

  • Comparative proteomics:

    • Compare protein abundance in wild-type versus atl59 mutant plants

    • Look for proteins that accumulate in the mutant, suggesting they are normal targets for degradation

  • Genetic approaches:

    • Suppressor screens of atl59 phenotypes

    • Synthetic lethality screens to identify genetic interactions

This comprehensive approach increases the likelihood of identifying true physiological substrates while minimizing false positives.

What are the best methods for analyzing ATL59 promoter activity in response to different stimuli?

To analyze ATL59 promoter activity in response to different stimuli, researchers should consider these methodological approaches:

  • Promoter-reporter fusion constructs:

    • Create PATL59:GUS or PATL59:LUC (luciferase) constructs

    • Generate stable transgenic Arabidopsis lines

    • Subject plants to various treatments and assess reporter activity

  • Promoter deletion analysis:

    • Create a series of 5' deletions of the promoter fused to reporters

    • Identify minimal regions required for response to specific stimuli

    • Identify specific cis-regulatory elements through site-directed mutagenesis

  • Chromatin immunoprecipitation (ChIP):

    • Identify transcription factors binding to the ATL59 promoter under different conditions

    • Perform ChIP-seq to map genome-wide binding profiles of relevant transcription factors

  • Real-time monitoring systems:

    • Use luciferase as a reporter for real-time, non-destructive monitoring of promoter activity

    • Employ automated imaging systems to capture dynamic responses to stimuli

  • Quantitative analysis:

    • Use fluorometric assays for GUS activity measurement

    • Implement image analysis software for quantifying reporter signals in different tissues

These approaches allow for comprehensive analysis of promoter activity across different tissues, developmental stages, and in response to various environmental cues.

How can ATL59 be used as a model to understand stress response mechanisms in plants?

ATL59 can serve as an excellent model for understanding plant stress response mechanisms:

  • As a regulatory component:

    • E3 ubiquitin ligases like ATL59 regulate protein turnover in response to stress

    • Studying ATL59 can reveal how post-translational regulation contributes to stress adaptation

    • ATL family proteins often show rapid induction in response to various stressors

  • Experimental approaches:

    • Generate atl59 knockout/knockdown mutants and assess stress sensitivity

    • Create overexpression lines to evaluate stress tolerance

    • Perform transcriptomic and proteomic analyses under stress conditions

    • Analyze changes in ATL59 protein levels, modifications, and localization during stress

  • Comparative studies:

    • Compare ATL59 function with other ATL family members (e.g., ATL9) to identify shared and unique mechanisms

    • Investigate conservation of stress response pathways across different plant species

  • Pathway integration:

    • Map ATL59's position in stress signaling networks through genetic and biochemical approaches

    • Identify upstream regulators and downstream effectors

    • Determine how ATL59 interfaces with other stress response pathways, such as oxidative stress responses

Such studies can provide valuable insights into how plants adapt to environmental challenges through targeted protein degradation.

What are the considerations for interpreting ATL59 localization data in cellular compartments?

When interpreting ATL59 localization data, researchers should consider several important factors:

  • Technical considerations:

    • Potential artifacts from overexpression of fusion proteins

    • Interference of tags with localization signals

    • Resolution limitations of different microscopy techniques

    • Fixation artifacts in immunolocalization studies

  • Biological variables:

    • Changes in localization during development or stress conditions

    • Potential for multiple localizations of the same protein

    • Rapid turnover affecting detection, particularly given the short-lived nature of ATL proteins

    • Post-translational modifications that may affect localization

  • Experimental approaches:

    • Compare N- and C-terminal fusion proteins to minimize tag interference

    • Use multiple independent methods (GFP fusion, immunolocalization, cell fractionation)

    • Employ co-localization with known compartment markers

    • Analyze localization in both native expression and controlled expression systems

    • Consider using transmembrane domain deletion variants to assess domain contributions to localization

  • Control experiments:

    • Include known controls for each cellular compartment

    • Verify functionality of fusion proteins through complementation studies

    • Use inducible expression systems to monitor localization dynamics

Careful consideration of these factors ensures accurate interpretation of localization data in the context of ATL59 function.

How should researchers address contradictory results in ATL59 expression studies?

When facing contradictory results in ATL59 expression studies, researchers should systematically investigate potential sources of variation:

  • Methodological differences:

    • Compare detection methods (qPCR, RNA-seq, Northern blot, Western blot)

    • Assess antibody specificity and detection limits

    • Evaluate normalization procedures and reference genes/proteins

  • Biological variables:

    • Consider plant age, tissue type, growth conditions, and circadian effects

    • Note that E3 ubiquitin ligases often show rapid turnover and tight regulation

    • Assess genetic background differences in Arabidopsis ecotypes

  • Systematic approach to resolution:

    • Reproduce experiments using standardized conditions

    • Employ multiple detection methods in parallel

    • Use appropriate controls (positive, negative, and procedural)

    • Consider time-course studies to capture transient expression patterns

    • Differentiate between transcriptional and post-translational regulation

  • Reconciliation strategies:

    • Develop integrated models that account for context-dependent regulation

    • Consider that contradictory results may reflect genuine biological complexity

    • Distinguish between mRNA abundance and protein levels, which may not correlate due to post-translational regulation

This systematic approach helps researchers resolve apparently contradictory findings and develop more comprehensive models of ATL59 regulation.

What are common pitfalls in analyzing ubiquitination activity of recombinant ATL59?

Researchers studying ubiquitination activity of recombinant ATL59 should be aware of these common pitfalls:

  • Protein preparation issues:

    • Loss of enzymatic activity during purification

    • Improper folding in heterologous expression systems

    • Aggregation due to hydrophobic transmembrane domains

    • Missing post-translational modifications required for activity

  • Assay-related challenges:

    • Non-physiological conditions in in vitro assays

    • Using incorrect E1 and E2 enzymes for the assay

    • Background ubiquitination from contaminating proteins

    • Buffer conditions affecting enzyme activity

    • Failure to include appropriate controls

  • Substrate-related issues:

    • Using non-physiological substrates

    • Substrate concentration not optimized

    • Substrates lacking necessary modifications or adaptor proteins

  • Detection limitations:

    • Insufficient sensitivity for detecting ubiquitinated products

    • Challenges in distinguishing mono- versus poly-ubiquitination

    • Difficulties in quantifying ubiquitination rates

  • Experimental design considerations:

    • Include positive controls with known E3 ligases

    • Use multiple detection methods (Western blot, mass spectrometry)

    • Verify function through complementation of atl59 mutants

    • Consider domain deletion studies to identify critical regions for activity

Awareness of these pitfalls allows researchers to design more robust experiments and interpret results with appropriate caution.

How might CRISPR/Cas9 gene editing enhance our understanding of ATL59 function?

CRISPR/Cas9 gene editing offers powerful new approaches for studying ATL59 function:

  • Precise genetic modifications:

    • Generate clean knockout mutants without marker genes

    • Create domain-specific mutations to assess functional contributions

    • Introduce specific point mutations to disrupt catalytic activity while maintaining protein structure

    • Generate tagged versions at endogenous loci to avoid overexpression artifacts

  • Regulatory element engineering:

    • Modify promoter elements to alter expression patterns

    • Create inducible systems for temporal control of ATL59 expression

    • Engineer reporter fusions at the native locus

  • High-throughput approaches:

    • Generate mutant libraries targeting different regions of ATL59

    • Perform multiplexed editing to study functional redundancy with other ATL family members

    • Create specific mutations in potential interaction interfaces

  • Applications in different genetic backgrounds:

    • Introduce identical mutations across Arabidopsis ecotypes to study genetic background effects

    • Create the same modifications in ATL homologs in crop species to assess conservation of function

  • Combinatorial studies:

    • Generate double/triple mutants with interacting partners

    • Combine ATL59 mutations with modifications in upstream regulators and downstream targets

These approaches allow for unprecedented precision in dissecting ATL59 function in its native genomic context.

What emerging technologies hold promise for elucidating ATL59 dynamics in live cells?

Several emerging technologies show particular promise for studying ATL59 dynamics in live cells:

  • Advanced imaging technologies:

    • Super-resolution microscopy (PALM, STORM, SIM) for detailed localization studies

    • Light sheet microscopy for long-term imaging with minimal phototoxicity

    • Single-molecule tracking to monitor protein movement and interactions

  • Protein dynamics tools:

    • Optogenetic control of ATL59 activity using light-sensitive domains

    • FRET/BRET biosensors to detect conformational changes and protein interactions

    • Split fluorescent proteins for visualizing protein-protein interactions in real time

    • Fluorescence correlation spectroscopy (FCS) to measure diffusion and interaction kinetics

  • Temporal control systems:

    • Degron-based approaches for rapid protein depletion

    • Chemical-inducible systems for precise temporal control of expression

    • Photoactivatable proteins for spatiotemporal control

  • Next-generation proximity labeling:

    • TurboID or miniTurbo for rapid biotin labeling of proximal proteins

    • APEX2 for electron microscopy-compatible proximity labeling

    • Integration with mass spectrometry for identifying transient interaction partners

  • In situ structural approaches:

    • Cryo-electron tomography for visualizing protein complexes in their native cellular environment

    • Integrative structural biology combining multiple data types

These technologies will enable researchers to observe the dynamic behavior of ATL59 with unprecedented resolution in space and time, providing new insights into its cellular functions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.