Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase ATL76 (ATL76)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
ATL76; At1g49210; F27J15.3; E3 ubiquitin-protein ligase ATL76; RING-H2 finger protein ATL76; RING-type E3 ubiquitin transferase ATL76
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ATL76
Target Protein Sequence
MSANELPASAQSLQEQFLGSFVTRKLLLHDPFDHNSLRVFAVAPSPLITHENNLKGNVLM LLSVLICGIICCLGLHYIIRCAFRRSSRFMISEPISSLSTPRSSSNKGIKKKALRMFPVV SYSREMNLPGIGEECVICLSDFVSGEQLRLLPKCNHGFHVRCIDKWLQHHLTCPKCRHCL VETCQKILGDFSQADSMASTPTESVIVRIDPLEPEGRVNTFRESS
Uniprot No.

Target Background

Function
Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase ATL76 (ATL76) is an E3 ubiquitin-protein ligase capable of catalyzing polyubiquitination with ubiquitin-conjugating enzyme E2 UBC8 in vitro.
Database Links

KEGG: ath:AT1G49210

STRING: 3702.AT1G49210.1

UniGene: At.38277

Protein Families
RING-type zinc finger family, ATL subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is ATL76 and what is its role in Arabidopsis thaliana?

ATL76 (At1g49210) is a RING-type E3 ubiquitin ligase belonging to the Arabidopsis Tóxicos En Levadura (ATL) subfamily. It contains a characteristic RING-H2 finger domain essential for its E3 ligase activity. The protein is 225 amino acids in length with a molecular structure that includes a transmembrane domain and a conserved RING-H2 domain .

While the specific function of ATL76 has not been fully characterized, it likely plays a role in plant stress responses similar to other ATL family members. The ATL gene family has been implicated in regulating plant responses to both biotic and abiotic stresses . For example, ATL31 and ATL6, two well-studied members of this family, positively regulate plant innate immunity and are also involved in salt stress responses .

Methodologically, to study ATL76 function, researchers typically employ:

  • Gene expression analysis under various stress conditions using qRT-PCR

  • Phenotypic analysis of knockout/knockdown and overexpression lines

  • Subcellular localization studies using GFP fusion proteins

  • Protein-protein interaction assays to identify potential substrates

How is the ATL family of E3 ubiquitin ligases organized in Arabidopsis?

The ATL family represents a substantial subset of RING-finger E3 ubiquitin ligases in Arabidopsis. According to comprehensive genomic analyses, Arabidopsis contains approximately 469 RING-finger domain proteins, which have been categorized based on sequence similarity and domain features .

The ATL gene family specifically consists of about 80 proteins in Arabidopsis, characterized by a RING-H2 type domain with a particular signature: a highly conserved proline spaced one residue upstream from the third zinc ligand, and a highly conserved tryptophan spaced three residues downstream from the sixth zinc ligand .

The following table summarizes key characteristics of the RING-finger E3 ligase family organization in Arabidopsis:

CategoryNumber in ArabidopsisKey Features
Total E3 ligases>1,000Approximately 5% of Arabidopsis genome
RING-finger proteins469Classified into multiple types (RING-H2, RING-HCa, etc.)
ATL family~80Contains characteristic RING-H2 domain with specific conserved residues
HECT E3 ligases7Named UPL1-UPL7, less expanded than in mammals

To study the evolutionary relationships within this family, researchers typically employ:

  • Phylogenetic analysis based on protein sequence alignments

  • Comparative genomics across multiple plant species

  • Analysis of gene structure and conserved motifs

What methods are used to express and purify recombinant ATL76 for experimental studies?

For experimental studies requiring recombinant ATL76, researchers typically use bacterial expression systems. Based on available protocols, the recommended methodology includes:

Expression System:

  • E. coli bacterial expression system is commonly used for recombinant ATL76 production

  • Full-length protein (1-225 amino acids) or functional domains can be expressed with affinity tags (typically His-tag)

Expression Protocol:

  • Clone the ATL76 coding sequence into an appropriate expression vector with an N-terminal His-tag

  • Transform into E. coli expression strain

  • Induce protein expression using IPTG or auto-induction methods

  • Harvest cells and lyse using appropriate buffer systems

Purification Strategy:

  • Affinity chromatography using Ni-NTA or similar matrices for His-tagged proteins

  • Further purification may include ion exchange and/or size exclusion chromatography

  • Buffer optimization to maintain protein stability

Storage Recommendations:

  • Store at -20°C/-80°C upon receipt

  • Aliquot to avoid repeated freeze-thaw cycles

  • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) for long-term storage

For researchers working with this protein, it's important to note that repeated freeze-thaw cycles should be avoided, and working aliquots can be stored at 4°C for up to one week .

How can researchers identify potential substrates of ATL76?

Identifying substrates of E3 ubiquitin ligases remains challenging due to the often transient nature of enzyme-substrate interactions. For ATL76, researchers can employ multiple complementary approaches:

Yeast Two-Hybrid (Y2H) Screening:

  • Clone ATL76 as bait (e.g., in pDEST32 vector fused with GAL4 DNA binding domain)

  • Screen against an Arabidopsis cDNA library

  • Validate positive interactions through reporter gene activation (e.g., ADE2, HIS3)

  • Confirm interactions using alternative methods

Co-Immunoprecipitation (Co-IP):

  • Express tagged versions of ATL76 in Arabidopsis (e.g., 35Spro::GFP-ATL76)

  • Immunoprecipitate protein complexes using tag-specific antibodies

  • Identify co-precipitated proteins via mass spectrometry

  • Validate with reciprocal Co-IP experiments

In Vitro Ubiquitination Assays:

  • Purify recombinant ATL76 and candidate substrate proteins

  • Perform ubiquitination reactions with E1, E2 enzymes, ubiquitin, and ATP

  • Detect ubiquitination by Western blot or mass spectrometry

  • Determine ubiquitin chain topology using chain-specific antibodies

Proteomics Approaches:

  • Compare ubiquitinome profiles between wild-type and atl76 mutant plants

  • Use quantitative proteomics to identify proteins with altered abundance

  • Employ techniques like ubiquitin remnant profiling to identify ubiquitination sites

The specificity of substrate recognition often involves E2 enzyme partners. For ATL family proteins, previous studies have shown interaction with specific E2 enzymes like UBC8 , which should be considered when designing in vitro assays.

To study the E3 ligase activity of ATL76 in vitro, researchers should consider the following methodological approaches:

In Vitro Ubiquitination Assay:

  • Components Required:

    • Purified recombinant ATL76 (E3)

    • E1 ubiquitin-activating enzyme

    • E2 ubiquitin-conjugating enzyme (preferably from the UBC8 family, known to work with RING-type E3 ligases)

    • Ubiquitin (unmodified or tagged)

    • ATP regeneration system

    • Potential substrate protein (if known)

  • Reaction Setup:

    • Mix components in appropriate buffer (typically Tris-based with DTT)

    • Incubate at 30°C for 1-3 hours

    • Stop reaction with SDS sample buffer

  • Detection Methods:

    • Western blot analysis using anti-ubiquitin antibodies

    • If substrate is known, use substrate-specific antibodies

    • For higher sensitivity, use mass spectrometry-based detection

E2 Enzyme Selection:
Previous studies with RING-type E3 ligases in Arabidopsis have shown that members of the UBC8 family (UBC8, 10, 11, 28, 29, 30) often serve as effective E2 partners . Testing multiple E2 enzymes is recommended as E3 ligases can show E2 specificity.

Auto-ubiquitination Assay:
If substrates are unknown, ATL76 auto-ubiquitination can serve as a proxy for E3 ligase activity:

  • Perform reaction without substrate

  • Detect ubiquitinated ATL76 using anti-tag antibodies

  • Confirm with mass spectrometry to identify ubiquitination sites

Chain-type Analysis:
To determine ubiquitin chain topology:

  • Use ubiquitin mutants with specific lysine mutations (K48R, K63R, etc.)

  • Employ chain-specific antibodies in Western blot

  • Analyze by mass spectrometry to identify linkage types

Controls and Validations:

  • Include negative controls (reactions missing E1, E2, ATP, or with catalytically inactive ATL76)

  • Use known E3-substrate pairs as positive controls

  • Validate with mutated versions of the RING domain of ATL76 (typically mutation of conserved cysteine residues)

How does recombination rate heterogeneity affect the genetic study of ATL76 and other E3 ubiquitin ligase genes?

Recombination rate heterogeneity significantly impacts genetic studies of ATL76 and other E3 ubiquitin ligase genes in Arabidopsis thaliana. This is particularly relevant when mapping quantitative trait loci (QTLs) or identifying genes through association studies.

Impact of Recombination Heterogeneity:

  • Gene Cluster Challenges: E3 ubiquitin ligase genes, including ATL family members, often occur in clusters in plant genomes . This clustering can create challenges for genetic mapping due to linkage disequilibrium, potentially masking individual gene effects.

  • Hotspots and Coldspots: Experimental studies have identified significant variation in recombination rates across the Arabidopsis genome. Some genes are associated with recombination hotspots, while others are in coldspots . This heterogeneity affects the resolution of genetic mapping studies.

  • Structural Heterozygosity Effects: Recombination can be suppressed in regions with structural heterozygosity, which may include duplications, inversions, or translocations affecting E3 ligase gene clusters .

Methodological Approaches to Address These Challenges:

  • Advanced Intercross Lines (AILs):

    • Utilize AI-RIL populations with expanded genetic maps (approximately 50 kb/cM compared to typical F2 populations)

    • These populations capture increased recombination events, improving mapping resolution

  • Fine Mapping Strategies:

    • Employ additional markers in regions of interest

    • Use dCAPs (derived cleaved amplified polymorphic sequences) markers for fine mapping

  • Whole Genome Sequencing Approaches:

    • Sequence the four products of meiotic tetrads to precisely map recombination events

    • This approach can identify crossover-associated gene conversions at nucleotide resolution

  • Consideration of Sequence Motifs:

    • Account for sequence motifs associated with recombination hotspots, such as:

      • GAA/CTT microsatellites (present in ~51% of recombination sites)

      • Poly-A homopolymers (present in ~76% of recombination sites)

  • Epigenetic Factors:

    • Consider DNA methylation status, as recombination events tend to occur in regions with lower methylation

    • Target gene promoters and gene ends, which are significantly overrepresented among recombination sites

The following data from Arabidopsis studies illustrates key considerations for genetic studies involving E3 ubiquitin ligase genes:

FactorEffect on RecombinationRelevance to E3 Ligase GenesReference
GC contentLower GC content associated with recombination sitesMay affect mapping resolution in GC-variable regions
DNA methylationLower methylation at recombination sitesE3 ligase genes in highly methylated regions may be harder to map
Sequence motifsGAA/CTT and poly-A motifs enriched at recombination sitesCan indicate potential recombination hotspots near E3 ligase genes
Genomic locationGene promoters and ends overrepresented at recombination sitesMay affect the precision of mapping regulatory regions

How can researchers investigate the tissue-specific and developmental regulation of ATL76 expression?

Understanding the tissue-specific and developmental regulation of ATL76 expression is crucial for elucidating its biological functions. Researchers can employ multiple complementary approaches:

Transcriptomic Analysis:

  • RNA-Seq Approaches:

    • Utilize existing Arabidopsis developmental transcriptome datasets, such as the AtMetExpress development dataset

    • Analyze RNA-seq data from specific tissues and developmental stages

    • Compare expression patterns across multiple tissues using standardized experimental designs

  • qRT-PCR Analysis:

    • Design gene-specific primers for ATL76

    • Use reference genes like Ubiquitin 10 (UBQ10: AT4G05320) for normalization

    • Collect RNA from different tissues at multiple developmental stages

    • Typical protocol: extract RNA from pooled samples (e.g., 4 plants per sample with 3 biological replicates)

Promoter Analysis:

  • Reporter Gene Constructs:

    • Clone the ATL76 promoter region (typically 1-2 kb upstream of start codon)

    • Fuse to reporter genes (GUS, GFP, LUC)

    • Generate stable transgenic Arabidopsis plants

    • Analyze reporter expression across tissues and developmental stages

  • Promoter Deletion Analysis:

    • Create a series of promoter deletions to identify regulatory elements

    • Analyze the effect of deletions on expression patterns

    • Identify tissue-specific regulatory elements

Protein Localization:

  • Fluorescent Protein Fusions:

    • Generate 35Spro::GFP-ATL76 or ATL76pro::ATL76-GFP constructs

    • Create stable transgenic plants

    • Analyze subcellular localization in different tissues using confocal microscopy

    • Compare localization patterns across developmental stages

Proteomics Approaches:

  • Tissue-Specific Proteome Analysis:

    • Use the Arabidopsis PeptideAtlas resource, which provides proteomics data across tissues

    • Compare protein abundance across different tissues

    • Combine with post-translational modification analysis

  • Protein Stability Assessment:

    • Analyze protein levels across tissues using western blotting

    • Compare transcript and protein levels to assess post-transcriptional regulation

Data Integration:

Combine multiple data types to create a comprehensive picture of ATL76 regulation:

Developmental StageTranscript Level (RNA-seq)Protein LevelSubcellular LocalizationPotential Function
Seedling[Data from datasets][Data from proteomics][Data from GFP studies][Inferred function]
Vegetative Growth[Data from datasets][Data from proteomics][Data from GFP studies][Inferred function]
Reproductive Stage[Data from datasets][Data from proteomics][Data from GFP studies][Inferred function]
Stress Response[Data from datasets][Data from proteomics][Data from GFP studies][Inferred function]

Mass spectrometry (MS) provides powerful tools for studying E3 ubiquitin ligases like ATL76. Here are methodological approaches for using MS to investigate ATL76:

Identification of ATL76 Substrates:

  • Ubiquitinome Analysis:

    • Compare ubiquitinated proteomes of wild-type and atl76 mutant plants

    • Enrich ubiquitinated peptides using ubiquitin remnant antibodies (K-ε-GG)

    • Identify peptides with decreased ubiquitination in atl76 mutants

    • Quantify using label-free or isotope labeling methods (SILAC, TMT)

  • Interaction Proteomics:

    • Express tagged ATL76 (e.g., TAP-tagged or FLAG-tagged)

    • Perform immunoprecipitation followed by MS (IP-MS)

    • Implement stringent controls to filter out non-specific interactions

    • Validate top candidates using alternative methods

  • Proximity Labeling:

    • Fuse ATL76 to a proximity labeling enzyme (BioID or TurboID)

    • Identify proteins in close proximity to ATL76 in vivo

    • Analyze biotinylated proteins by MS after streptavidin pulldown

Characterization of Ubiquitination Sites and Chain Types:

  • Ubiquitination Site Mapping:

    • Perform in vitro ubiquitination reactions with recombinant ATL76 and substrate

    • Digest with trypsin and analyze by MS

    • Identify peptides with the ubiquitin remnant (GG) modification

    • Determine preferential sites for ATL76-mediated ubiquitination

  • Ubiquitin Chain Topology Analysis:

    • Use specialized MS methods to analyze ubiquitin linkage types

    • Employ ubiquitin absolute quantification (AQUA) approaches

    • Determine if ATL76 preferentially generates specific chain types (K48, K63, etc.)

Post-translational Modification Analysis of ATL76:

  • PTM Mapping:

    • Purify ATL76 from plants under different conditions

    • Analyze by MS to identify phosphorylation, SUMOylation, or other modifications

    • Determine how PTMs affect ATL76 E3 ligase activity

  • Quantitative Analysis:

    • Compare PTM profiles under different stress or hormone treatments

    • Identify regulatory mechanisms controlling ATL76 activity

Proteome-wide Effects of ATL76 Mutation:

  • Differential Proteomics:

    • Compare protein abundance in wild-type and atl76 mutants

    • Identify proteins with altered stability potentially regulated by ATL76

    • Perform pathway enrichment analysis to identify affected processes

  • Temporal Dynamics:

    • Analyze protein turnover rates using pulse-chase MS approaches

    • Compare protein half-lives in wild-type and atl76 plants

Technical Considerations for Arabidopsis Proteomics:

Based on the Arabidopsis PeptideAtlas , researchers should consider:

Technical AspectRecommendationReference
Sample coverageInclude multiple tissues to improve proteome coverage
Protein detection18,267 canonical core proteins can be detected with current methods
Chromosome coverageConsider chromosome-specific detection rates (64-80% depending on chromosome)
Data processingUse Trans-Proteomic Pipeline for raw data processing

The Arabidopsis PeptideAtlas contains data from 369 experiments and over 70 million peptide-spectrum matches, providing a valuable resource for comparing experimental results .

What evolutionary insights can be gained from studying ATL76 compared to other E3 ubiquitin ligases?

Evolutionary analysis of ATL76 can provide valuable insights into its function and importance. Here are methodological approaches to study the evolution of ATL76 and related E3 ubiquitin ligases:

Phylogenetic Analysis:

  • Family-Wide Phylogeny:

    • Construct phylogenetic trees of the ATL family within Arabidopsis

    • Compare with ATL families in other plant species

    • Identify orthologous relationships and evolutionary patterns

    • Use methods like maximum likelihood or Bayesian inference

  • Domain Evolution:

    • Analyze the RING-H2 domain conservation across species

    • Identify selection pressures on functional domains

    • Compare transmembrane domains and other structural features

Comparative Genomics:

  • Synteny Analysis:

    • Analyze genomic regions containing ATL76 across plant species

    • Identify syntenic relationships and genomic rearrangements

    • Determine if ATL76 is in a conserved chromosomal context

  • Copy Number Variation:

    • Compare the number of ATL family genes across plant lineages

    • Identify lineage-specific expansions or contractions

    • Relate gene family size to potential functional diversification

Molecular Evolution:

  • Selection Analysis:

    • Calculate dN/dS ratios to identify selection patterns

    • Use branch-site models to detect episodic selection

    • Compare selection patterns between different plant lineages

  • Coevolution Analysis:

    • Identify potential coevolution between ATL76 and its interacting partners

    • Use methods like mutual information analysis or statistical coupling analysis

    • Determine if substrate recognition domains coevolve with target proteins

Structural Evolution:

  • Protein Structure Prediction:

    • Generate structural models of ATL76 from different species

    • Compare structural features across evolutionary time

    • Identify conserved binding surfaces and catalytic residues

  • Ancestral Sequence Reconstruction:

    • Reconstruct ancestral ATL proteins

    • Compare biochemical properties of ancestral and extant proteins

    • Infer functional shifts during evolution

Comparative E3 Ligase Evolution:

The evolution of E3 ligase families in plants shows interesting patterns:

E3 Ligase TypeEvolutionary Pattern in PlantsComparison to ATL FamilyReference
HECT E3 ligasesLimited expansion (7 genes in Arabidopsis)Contrasts with extensive ATL family expansion
RING-finger E3sGreatly expanded (469 genes in Arabidopsis)ATL family represents significant subfamily
F-box proteinsMassively expanded in plantsDifferent substrate recognition mechanism

Application to ATL76 Research:

Based on evolutionary insights, researchers can:

  • Target highly conserved regions for functional studies

  • Identify lineage-specific features that may relate to specialized functions

  • Predict potential substrates based on coevolutionary patterns

  • Design experiments testing functional conservation across species

Unlike HECT E3 ligases, which show limited expansion in plants compared to animals , the ATL family has undergone significant expansion, suggesting important plant-specific functions that have been selected for during evolution.

What are the best experimental controls for studying ATL76 E3 ligase activity?

When studying ATL76 E3 ligase activity, proper experimental controls are essential for generating reliable and interpretable results. Here are the recommended controls for different experimental approaches:

For In Vitro Ubiquitination Assays:

  • Negative Controls:

    • Reaction missing E1 enzyme (tests E1 dependency)

    • Reaction missing E2 enzyme (tests E2 dependency)

    • Reaction missing ATP (confirms ATP requirement)

    • Reaction with catalytically inactive ATL76 (mutation in RING domain)

    • Reaction with unrelated protein instead of ATL76 (specificity control)

  • Positive Controls:

    • Well-characterized E3-substrate pair (e.g., SINAT5-NAC1)

    • Auto-ubiquitination of wild-type ATL76 (often detectable even without substrate)

For Protein-Protein Interaction Studies:

  • Y2H Controls:

    • Empty vector controls (pDEST22/pDEST32 without inserts)

    • Positive interaction control pairs

    • Test for auto-activation with single constructs

    • Confirmation using multiple reporter genes (e.g., ADE2, HIS3)

  • Co-IP Controls:

    • Non-specific IgG control

    • Unrelated protein with same tag as ATL76

    • Input sample (pre-immunoprecipitation)

    • Reverse Co-IP (immunoprecipitate suspected interactor)

For Genetic Studies:

  • Multiple Alleles:

    • Use multiple independent T-DNA insertion or CRISPR-generated alleles

    • Complementation testing with wild-type ATL76 genomic sequence

    • Consider using an artificial microRNA approach as an alternative

  • Overexpression Controls:

    • Empty vector transformants

    • Overexpression of catalytically inactive ATL76

    • Dose-response testing with multiple independent lines

For Stress Response Studies:

  • Timing Controls:

    • Include multiple time points to capture transient responses

    • Compare to known stress-responsive genes as positive controls

  • Specificity Controls:

    • Test multiple stress types (e.g., salt, drought, pathogen)

    • Include known stress-responsive E3 ligases as comparators (e.g., ATL31/ATL6)

For Expression Analysis:

  • qRT-PCR Controls:

    • No template controls

    • No reverse transcriptase controls

    • Multiple reference genes (e.g., UBQ10, as used in related studies)

    • Technical and biological replicates (typically 3 biological replicates with 3-4 technical replicates each)

  • Western Blot Controls:

    • Loading controls (housekeeping proteins)

    • Protein from knockout lines (antibody specificity control)

    • Recombinant protein standard curve (for quantification)

Implementing these controls will help ensure experimental rigor and reproducibility when studying ATL76 and other E3 ubiquitin ligases.

How can researchers address challenges in detecting transient ubiquitination events mediated by ATL76?

Detection of transient ubiquitination events mediated by E3 ligases like ATL76 presents significant technical challenges. Here are methodological approaches to overcome these challenges:

Strategies to Stabilize Ubiquitinated Proteins:

  • Proteasome Inhibition:

    • Treat plant tissues with MG132 or other proteasome inhibitors

    • Typically use 50-100 μM MG132 for 3-6 hours before harvesting

    • Include 2.5 mM NaF, 1.5 mM Na3VO4, and cOmplete™ Protease Inhibitor Cocktail in extraction buffers

  • Deubiquitinase (DUB) Inhibition:

    • Add N-ethylmaleimide (NEM, 5-10 mM) to extraction buffers

    • Include other DUB inhibitors like PR-619 or 1,10-phenanthroline

    • Maintain samples at 4°C during processing

  • Tandem Ubiquitin Binding Entities (TUBEs):

    • Use TUBEs to capture and protect ubiquitinated proteins

    • Incorporate TUBEs in pulldown experiments to enrich ubiquitinated substrates

    • Apply this approach to identify ATL76-specific substrates

Advanced Detection Methods:

  • Proximity-Dependent Labeling:

    • Fuse ATL76 to BioID or TurboID

    • Express in plants to biotinylate proteins in close proximity

    • Isolate biotinylated proteins under stringent conditions

    • Identify by mass spectrometry

  • FRET-Based Sensors:

    • Develop FRET sensors for candidate substrate ubiquitination

    • Monitor ubiquitination events in real-time in vivo

    • Analyze spatial and temporal dynamics of ubiquitination

  • Split-Ubiquitin System:

    • Adapt split-ubiquitin systems for in planta studies

    • Enable detection of transient interactions leading to ubiquitination

    • Visualize interactions using reporter proteins

Pulse-Chase Approaches:

  • Inducible Expression Systems:

    • Create inducible ATL76 expression systems (e.g., estradiol-inducible)

    • Induce expression and monitor substrate levels over time

    • Combine with cycloheximide treatment to block new protein synthesis

  • Protein Synthesis Inhibition:

    • Treat with cycloheximide to block protein synthesis

    • Monitor degradation kinetics of candidate substrates

    • Compare degradation rates in wild-type vs. atl76 mutant backgrounds

Sample Preparation Optimization:

  • Rapid Tissue Harvesting:

    • Flash-freeze tissues in liquid nitrogen

    • Implement grinding under liquid nitrogen

    • Use denaturing conditions immediately upon tissue disruption

  • Buffer Optimization:

    • Include 8M urea or 1% SDS in initial extraction

    • Use TCA precipitation to concentrate proteins

    • Implement HPLC fractionation to enrich for ubiquitinated peptides

Mass Spectrometry Approaches:

  • Targeted Proteomics:

    • Develop selective reaction monitoring (SRM) or parallel reaction monitoring (PRM) assays

    • Focus on predicted ubiquitination sites of candidate substrates

    • Increase sensitivity for low-abundance modified peptides

  • Enrichment Strategies:

    • Use tandem ubiquitin binding domains for enrichment

    • Employ anti-K-ε-GG antibodies to capture ubiquitinated peptides

    • Implement hydroxy acid-based chemical enrichment of ubiquitinated peptides

These methodological approaches can be combined to create a comprehensive strategy for detecting the often challenging transient ubiquitination events mediated by ATL76 or other E3 ubiquitin ligases in plants.

What considerations should researchers keep in mind when interpreting phenotypes of ATL76 mutant plants?

Genetic Background Considerations:

  • Allele Verification:

    • Confirm the nature of the mutation (T-DNA insertion position, CRISPR-induced changes)

    • Verify by sequencing and expression analysis (qRT-PCR)

    • Check for potential truncated proteins using Western blot

  • Functional Redundancy:

    • Consider the 80 members of the ATL family in Arabidopsis

    • Generate higher-order mutants with closely related ATL genes

    • Use artificial microRNAs to simultaneously downregulate multiple family members

  • Background Mutations:

    • Backcross to wild-type at least 3-5 times to clean genetic background

    • Use multiple independent alleles to confirm phenotypes

    • Consider using genome editing to create clean mutations

Experimental Design Considerations:

  • Growth Conditions:

    • Strictly control growth conditions (light, temperature, humidity)

    • Include internal controls in each experiment

    • Consider circadian effects (time of day for measurements)

    • Use growth chambers rather than greenhouse when possible

  • Developmental Stage:

    • Analyze phenotypes across multiple developmental stages

    • Use consistent methods to determine developmental stages

    • Consider using the Arabidopsis meristem development timeline as reference

  • Stress Conditions:

    • For stress-related phenotypes, carefully control stress application

    • Include appropriate stress-sensitive and stress-resistant controls

    • Monitor multiple stress markers to confirm stress levels

Phenotypic Analysis Methods:

  • Quantitative Phenotyping:

    • Use automated phenotyping platforms when available

    • Implement image analysis software for unbiased measurements

    • Establish clear phenotyping protocols with adequate sample sizes

  • Cellular and Subcellular Analysis:

    • Complement whole-plant phenotyping with cellular analysis

    • Analyze cell division patterns, cell size, and subcellular structures

    • Use fluorescent markers to track specific cellular processes

Molecular Context:

  • Expression Analysis:

    • Analyze global expression changes in mutants (RNA-seq)

    • Validate key genes by qRT-PCR

    • Consider tissue-specific expression analysis

  • Protein Levels:

    • Check levels of potential substrate proteins

    • Analyze protein stability in wild-type vs. mutant backgrounds

    • Monitor ubiquitination status of candidate proteins

Environmental Interactions:

  • Genotype × Environment Interactions:

    • Test phenotypes under multiple environmental conditions

    • Consider natural variation in responses

    • Use advanced intercross populations for QTL analysis if relevant

  • Microbiome Effects:

    • Consider soil microbiome effects on phenotypes

    • Use sterile growth conditions when appropriate

    • Include microbiome transplant experiments if relevant

Statistical Considerations:

  • Appropriate Statistical Analysis:

    • Use sufficient biological replicates (minimum n=10 for subtle phenotypes)

    • Apply appropriate statistical tests based on data distribution

    • Control for multiple testing when screening many parameters

  • Effect Size Estimation:

    • Report effect sizes, not just p-values

    • Consider the biological significance of observed differences

    • Use power analysis to determine adequate sample sizes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.