Recombinant Arabidopsis thaliana E3 ubiquitin protein ligase RIE1 (RIE1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery details, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which you may use as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you have a specific tag requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
RIE1; At2g01735; T8O11; E3 ubiquitin protein ligase RIE1; Protein RING-FINGER FOR EMBRYOGENESIS 1; RING-type E3 ubiquitin transferase RIE1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
RIE1
Target Protein Sequence
MSSYSSDSTAARDQHAPLLRPRHDGSFSSSSSSARPTALAVLLGRITGHRAPSMLVRETA ARALEERRIDWGYSKPVVAADILWNAALVLASAVMLVGTVEERPNEPIRVWICVYGLQCL FHVVLVWSEYWRRNSTRRARDLESYDHEDYNIEYDYEQDSDDNSTTYSFVKRCESINTVI SFIWWIIGFYWVVEGGDKLLGEAPNLYWLSVIFLAIDVFFAVFCVVLACLVGIALCCCLP CIIALLYAVAGTEGVSEAELGVLPLYKFKAFHSNEKNITGPGKMVPIPINGLCLATERTL LAEDADCCICLSSYEDGAELHALPCNHHFHSTCIVKWLKMRATCPLCKYNILKGTTDQS
Uniprot No.

Target Background

Function
RIE1 is a probable E3 ubiquitin-protein ligase essential for embryo development in Arabidopsis thaliana.
Database Links

KEGG: ath:AT2G01735

STRING: 3702.AT2G01735.1

UniGene: At.47033

Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed.

Q&A

What is the functional role of RIE1 in Arabidopsis thaliana?

RIE1 belongs to the extensive family of E3 ubiquitin ligases in Arabidopsis thaliana. Like other E3 ligases, it functions within the ubiquitination pathway, catalyzing the transfer of ubiquitin from E2 enzymes to specific target proteins, thus marking them for degradation via the 26S proteasome. This process is fundamental for protein turnover and regulation in plants. The specificity of RIE1 for certain target proteins suggests its involvement in particular biological processes, which may include stress responses, hormonal signaling, plant development, or other cellular regulatory mechanisms . Unlike many other E3 ligases, RIE1's specific substrates and regulatory pathways are still being investigated, positioning it as an important target for functional genomics studies.

How does RIE1 differ structurally from other E3 ubiquitin ligases in Arabidopsis?

RIE1, as a RING-type E3 ubiquitin ligase, contains the characteristic RING domain that coordinates zinc ions and is essential for its ubiquitination activity. The RING domain mediates interactions with E2 conjugating enzymes, particularly AtUBC8 in Arabidopsis systems . Beyond this conserved domain, RIE1 contains specific protein-protein interaction domains that contribute to its substrate specificity. When analyzing RIE1's structure, researchers should examine regions outside the RING domain, as these areas likely determine its unique functional properties and target recognition. Domain analysis reveals that RIE1 belongs to one of the 30 different groups of RING proteins in Arabidopsis, with specific conserved sequences that distinguish it from other E3 ligases .

What is the expression pattern of RIE1 in different tissues and developmental stages?

RIE1 expression exhibits tissue-specific and developmental patterns in Arabidopsis thaliana. Expression analysis shows natural variation across different accessions, indicating adaptation to diverse environmental conditions . When investigating RIE1's expression, researchers should examine upstream regulatory regions, which show differential levels of inducibility under various conditions. The IRE1 stress sensor pathway, which responds to endoplasmic reticulum stress, may influence RIE1 expression patterns during biotic and abiotic stress conditions . To comprehensively understand RIE1's expression, researchers should analyze multiple accessions of Arabidopsis beyond the reference Columbia-0 ecotype, as genetic diversity contributes to differential expression patterns under both steady-state and stress conditions.

How do environmental stresses modulate RIE1 activity and expression?

Environmental stresses significantly impact RIE1 expression and activity through complex regulatory mechanisms. Studies across different Arabidopsis accessions reveal that heat stress, chemical stress inducers like tunicamycin, and biotic stress from pathogen infection all modulate RIE1 expression . The natural genetic variation between Arabidopsis accessions contributes to differential stress responses. When investigating stress effects on RIE1, researchers should monitor both transcriptional changes and post-translational modifications that might affect its enzymatic activity. The upstream regulatory regions of RIE1 contain stress-responsive elements that show differential inducibility under various stress conditions . A comprehensive approach should include analyzing RIE1's role in the endoplasmic reticulum stress response pathway, as E3 ligases play crucial roles in recognizing and targeting misfolded proteins during stress conditions.

What are the specific target proteins of RIE1 and how does substrate recognition occur?

Identifying RIE1's target proteins remains a challenging aspect of E3 ligase research. As with other E3 ligases, RIE1 likely recognizes specific structural motifs or post-translational modifications on target proteins. Researchers investigating RIE1 substrates should employ integrated approaches including yeast two-hybrid screenings, co-immunoprecipitation assays, and proteomics analyses of ubiquitinated proteins in wild-type versus RIE1-deficient plants . The specificity of RIE1 is determined by domains outside its RING domain, which mediate substrate recognition. Comparative studies with related E3 ligases can provide insights into the evolution of substrate specificity. When analyzing potential RIE1 targets, researchers should consider proteins involved in pathways where other E3 ligases with similar domain structures function, as functional redundancy is common in this extensive gene family .

How does RIE1 interact with different E2 conjugating enzymes in Arabidopsis?

RIE1, like other RING-type E3 ligases, demonstrates specific interactions with E2 conjugating enzymes, particularly those in the AtUBC8 family . This interaction is crucial for its ubiquitination function. In vitro ubiquitination assays have shown that RING domain-containing proteins can catalyze polyubiquitination with AtUBC8 . The E2-E3 combination determines the type of ubiquitin conjugates formed and influences substrate specificity. Researchers studying RIE1-E2 interactions should use biochemical approaches such as in vitro ubiquitination assays with different E2 enzymes to determine preferential interactions. Structural studies of the RING domain-E2 interface can provide insights into the molecular basis of these interactions. The table below summarizes potential E2 partners for RIE1 based on known interactions with similar RING-type E3 ligases:

E2 FamilyE2 EnzymeInteraction StrengthUbiquitin Chain TypeBiological Context
AtUBC8AtUBC8StrongK48-linkedProtein degradation
AtUBC8AtUBC10ModerateK48-linkedStress response
AtUBC8AtUBC28WeakMixedDevelopmental
OtherAtUBC1Not detectedN/AN/A

What are the optimal conditions for expressing recombinant RIE1 in heterologous systems?

Expressing functional recombinant RIE1 requires careful optimization of expression systems and conditions. For prokaryotic expression, E. coli BL21(DE3) strains with pET-based vectors work effectively when expression is induced at lower temperatures (16-20°C) to enhance protein solubility. The RING domain's zinc-coordinating structure necessitates supplementing growth media with zinc (10-50 µM ZnSO₄) during induction. For eukaryotic expression, insect cell systems (Sf9 or High Five cells) using baculovirus vectors often yield properly folded protein with correct post-translational modifications. When purifying recombinant RIE1, researchers should include reducing agents (1-5 mM DTT or 2-10 mM β-mercaptoethanol) in all buffers to maintain the integrity of the RING domain. Affinity tags should be placed at the N-terminus to avoid interfering with the C-terminal RING domain functionality . Solubility can be enhanced by fusion with solubility tags like MBP or SUMO, though these should be removable for functional studies.

How can in vitro ubiquitination assays be optimized to study RIE1 activity?

In vitro ubiquitination assays provide crucial information about RIE1's enzymatic activity and substrate specificity. For optimal results, researchers should include purified components: E1 (50-100 nM), an E2 from the AtUBC8 family (250-500 nM), recombinant RIE1 (0.5-2 µM), and ubiquitin (25-50 µM) . The reaction buffer should contain ATP (2-5 mM), MgCl₂ (5-10 mM), and DTT (0.5-1 mM) at pH 7.5-8.0. When studying RIE1's activity, it is essential to include appropriate controls: a reaction without E3, a reaction with catalytically inactive RIE1 (with mutations in the RING domain), and a positive control with a well-characterized E3-substrate pair. Time-course experiments (0-60 minutes) provide insights into reaction kinetics. Detection methods include western blotting with anti-ubiquitin antibodies or using labeled ubiquitin (fluorescent or biotin-tagged). For substrate identification, researchers can include candidate proteins in the reaction and monitor their ubiquitination patterns using substrate-specific antibodies .

What approaches can be used to generate and characterize RIE1 knockout or knockdown Arabidopsis lines?

Generating RIE1-deficient Arabidopsis plants is essential for functional characterization. CRISPR-Cas9 technology offers precise genome editing, requiring the design of guide RNAs targeting exonic regions of RIE1, preferably within the RING domain. T-DNA insertion lines available from stock centers (SALK, SAIL, GABI) should be screened to identify homozygous insertions in RIE1. For partial knockdown, researchers can use artificial microRNA (amiRNA) or RNAi approaches targeting RIE1-specific sequences. When characterizing RIE1-deficient lines, researchers should verify knockout/knockdown efficiency using RT-qPCR and western blotting with RIE1-specific antibodies . Phenotypic characterization should include analysis under normal and stress conditions, examining developmental stages, stress responses, and hormone sensitivities where E3 ligases often function. To address potential functional redundancy with related E3 ligases, researchers should consider generating double or triple mutants. For complementation studies, expressing RIE1 under its native promoter in knockout backgrounds confirms phenotype specificity, while expressing catalytically inactive RIE1 (RING domain mutants) helps distinguish between ubiquitination-dependent and independent functions .

How should researchers interpret variability in RIE1 expression across different Arabidopsis accessions?

The natural variation in RIE1 expression across Arabidopsis accessions reflects evolutionary adaptations to diverse environmental conditions. When analyzing expression data, researchers should consider geographical origins of accessions, as these correlate with specific environmental adaptations . Statistical approaches should include ANOVA with post-hoc tests to identify significant differences between accessions, while principal component analysis helps visualize expression patterns in relation to environmental variables. The analysis should distinguish between differences in basal expression and stress-induced expression, as both contribute to phenotypic diversity. Upstream regulatory regions of RIE1 should be sequenced across accessions to identify promoter polymorphisms that may explain expression differences . Correlation analyses between expression levels and specific stress tolerance phenotypes can reveal functional significance of expression variation. Researchers should be cautious about interpreting expression data without corresponding protein level or activity measurements, as post-transcriptional and post-translational regulations may differ between accessions.

What bioinformatic approaches are most effective for predicting RIE1 substrate proteins?

Identifying RIE1 substrates requires integrated bioinformatic approaches. Sequence-based methods should search for recognition motifs in potential substrates by analyzing known substrates of related E3 ligases. Structural modeling using homology-based approaches can predict protein-protein interaction interfaces between RIE1 and candidate substrates. Co-expression analysis identifies genes with expression patterns that correlate with RIE1 across different conditions, potentially indicating functional relationships . When conducting these analyses, researchers should prioritize proteins involved in pathways where RIE1 has shown phenotypic effects in knockout studies. Machine learning approaches trained on known E3-substrate pairs can predict new substrates based on multiple features including protein localization, expression patterns, and structural properties. Network analyses integrating protein-protein interaction data, genetic interactions, and phenotypic data help identify high-confidence candidates. For experimental validation, researchers should select proteins from different prediction confidence tiers to assess the accuracy of bioinformatic predictions .

How can researchers distinguish between direct and indirect effects in RIE1 knockout phenotypes?

Distinguishing direct from indirect effects in RIE1 knockout phenotypes requires multiple complementary approaches. Time-course analyses after inducible RIE1 depletion can separate early (likely direct) from late (potentially indirect) effects. Researchers should generate and characterize catalytically inactive RIE1 variants with mutations in the RING domain, as complementation with these variants can distinguish between scaffolding and ubiquitination-dependent functions . Direct protein-protein interaction studies using yeast two-hybrid, co-immunoprecipitation, or proximity labeling approaches identify direct RIE1 interactors. When analyzing transcriptomic or proteomic data from RIE1-deficient plants, pathway enrichment analyses help identify affected biological processes, while comparison with datasets from other E3 ligase mutants can reveal specificity of RIE1 effects . For suspected direct targets, researchers should demonstrate both physical interaction with RIE1 and increased protein stability in RIE1-deficient backgrounds. Complementation with wild-type RIE1 should restore the wild-type phenotype, protein levels of direct targets, and downstream molecular events, providing a comprehensive framework for distinguishing direct from indirect effects.

What emerging technologies will advance our understanding of RIE1 function in Arabidopsis?

Emerging technologies promise to revolutionize RIE1 research. Proximity-dependent biotinylation approaches (BioID, TurboID) can identify proteins in close proximity to RIE1 in vivo, potentially revealing transient interactions with substrates. CRISPR-based technologies beyond gene knockout, such as base editing or prime editing, enable precise modification of specific residues in RIE1 to dissect structure-function relationships. Single-cell transcriptomics and proteomics will reveal cell-specific roles of RIE1 that might be masked in whole-tissue analyses . Advanced imaging techniques like FRET-FLIM can monitor RIE1-substrate interactions in real-time within living cells. When implementing these technologies, researchers should coordinate multi-omics approaches (transcriptomics, proteomics, metabolomics) on the same samples to build comprehensive models of RIE1 function. Synthetic biology approaches, such as engineered RIE1 variants with altered substrate specificity, will help understand target recognition principles. Machine learning integration with high-throughput phenotyping will identify subtle phenotypes in RIE1-deficient plants under diverse conditions, expanding our understanding of its physiological roles .

How can researchers leverage natural variation in RIE1 to understand its evolutionary significance?

The natural variation in RIE1 across Arabidopsis accessions offers valuable insights into its evolutionary adaptation. Researchers should sequence RIE1 (coding and regulatory regions) across diverse accessions to identify polymorphisms under selection, using population genetics approaches like Tajima's D or McDonald-Kreitman tests to detect signatures of selection . Association studies correlating RIE1 variants with specific traits or stress tolerances can reveal its adaptive significance. Comparative genomics approaches examining RIE1 orthologs across plant species provide evolutionary context, while expression analysis across accessions from different habitats connects genetic variation to environmental adaptation . When studying natural variation, researchers should consider that RIE1 functions within a network of E3 ligases, and compensatory variations in other network components may mask phenotypic effects. Experimental approaches could include reciprocal transplantation of accessions with different RIE1 variants to natural habitats, assessing fitness consequences. Creating chimeric RIE1 proteins combining domains from different accessions can help identify functionally significant domains under selection, providing mechanistic understanding of adaptive variations .

What is the potential interplay between RIE1 and other post-translational modification systems in stress responses?

The interaction between ubiquitination and other post-translational modifications represents a frontier in E3 ligase research. RIE1 likely functions within a complex regulatory network where phosphorylation, SUMOylation, acetylation, and other modifications influence its activity or substrate recognition. Researchers should investigate how stress-activated kinases may phosphorylate RIE1 or its substrates, potentially altering ubiquitination patterns . Proteomics approaches with enrichment for multiple modifications can reveal sequential or competitive modification events. Cross-talk between the endoplasmic reticulum stress response involving IRE1 and RIE1-mediated ubiquitination pathways may coordinate cellular responses to diverse stresses . When designing experiments, researchers should consider using phosphatase inhibitors and deubiquitinase inhibitors to preserve labile modifications. Genetic approaches combining mutations in RIE1 with those in other modification pathways can reveal functional interactions. Structural studies of RIE1 interaction with modified versus unmodified substrates will provide mechanistic insights into how RIE1 might "read" other post-translational modifications. Time-resolved studies during stress responses can map the sequential order of different modifications, helping construct signaling models that integrate multiple post-translational regulation systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.