Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase RMA1 (RMA1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
RMA1; At4g03510; F9H3.14; E3 ubiquitin-protein ligase RMA1; Protein RING membrane-anchor 1; RING-type E3 ubiquitin transferase RMA1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-249
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
RMA1
Target Protein Sequence
MALDQSFEDAALLGELYGEGAFCFKSKKPEPITVSVPSDDTDDSNFDCNICLDSVQEPVVTLCGHLFCWPCIHKWLDVQSFSTSDEYQRHRQCPVCKSKVSHSTLVPLYGRGRCTTQEEGKNSVPKRPVGPVYRLEMPNSPYASTDLRLSQRVHFNSPQEGYYPVSGVMSSNSLSYSAVLDPVMVMVGEMVATRLFGTRVMDRFAYPDTYNLAGTSGPRMRRRIMQADKSLGRIFFFFMCCVVLCLLLF
Uniprot No.

Target Background

Function
Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase RMA1 (RMA1) is an E3 ubiquitin-protein ligase that facilitates the ubiquitination and subsequent proteasomal degradation of aquaporin PIP2-1. It forms a ubiquitin ligase complex in conjunction with the E2 enzymes UCB8/UCB10.
Gene References Into Functions
  1. RMA1, RMA2, and RMA3 exhibit E3 ubiquitin ligase activity and are localized to the endoplasmic reticulum. PMID: 19224217
Database Links

KEGG: ath:AT4G03510

STRING: 3702.AT4G03510.1

UniGene: At.239

Subcellular Location
Endoplasmic reticulum membrane; Single-pass type IV membrane protein.
Tissue Specificity
Ubiquitous. Highly expressed in roots.

Q&A

What is RMA1 and what are its main structural features?

RMA1 (RING Membrane-Anchor 1) is a 28 kDa E3 ubiquitin ligase in Arabidopsis thaliana characterized by two key structural domains: a RING finger motif near the N-terminus and a C-terminal membrane-anchoring domain. The RING domain coordinates two zinc atoms and is essential for its E3 ligase activity. The C-terminal transmembrane domain anchors the protein to the endoplasmic reticulum membrane . Structural analysis has identified RMA1 as part of a family that includes RMA1, RMA2, and RMA3 in Arabidopsis, all of which localize to the endoplasmic reticulum and possess E3 ubiquitin ligase activity .

How is RMA1 E3 ligase activity demonstrated experimentally?

RMA1's E3 ligase activity can be demonstrated through in vitro ubiquitination assays. This is typically done by:

  • Expressing RMA1 as a fusion protein (commonly with maltose binding protein, MBP)

  • Incubating the recombinant protein with purified components of the ubiquitination cascade (ubiquitin, E1, and specific E2 enzymes)

  • Detecting ubiquitination activity via immunoblot analysis with anti-ubiquitin antibodies

Studies have shown that RMA1 specifically functions with the Ubc4/5 subfamily of E2 enzymes but not with other E2 enzymes such as E2-20k, E2-25k, Ubc3, or Ubc8 . Site-directed mutagenesis of key residues in the RING domain (such as His58, Cys61, and Cys89) abolished the E3 ligase activity, confirming the essential role of the RING domain for enzymatic function .

Where is RMA1 localized in plant cells and how is this determined?

RMA1 is primarily localized to the endoplasmic reticulum (ER) membrane. This localization has been demonstrated through:

  • Fluorescent protein fusion experiments using GFP-tagged RMA1 constructs in Arabidopsis protoplasts

  • Co-localization experiments with established ER markers such as BiP-GFP and GKX

  • Immunostaining with specific antibodies against epitope-tagged RMA1 variants

When expressed in plant cells, GFP-RMA1 displays a characteristic network pattern typical of ER-localized proteins. Experiments using hemagglutinin (HA)-tagged RMA1 have confirmed that this localization is not an artifact of the GFP tag . The transmembrane domain at the C-terminus is responsible for this membrane anchoring, making RMA1 one of the few characterized membrane-bound E3 ubiquitin ligases in plants .

What expression systems are optimal for producing recombinant RMA1 protein?

For functional studies of RMA1, several expression systems have been successfully employed:

Expression SystemAdvantagesLimitationsRecommended Applications
Bacterial (E. coli)High yield, cost-effective, suitable for in vitro enzyme assaysLacks post-translational modifications, potential folding issues with membrane domainsIn vitro ubiquitination assays, antibody production
Plant cell-based (protoplasts)Native environment, proper folding and modificationsLower yield, technically challengingLocalization studies, interaction studies with plant substrates
Cell-free systems (wheat germ)Maintains plant-specific modifications, rapidExpensive, lower yieldQuick enzymatic assays, screening protein variants

How can potential substrates of RMA1 be identified and validated?

Identifying and validating RMA1 substrates requires a multi-faceted approach:

  • Initial identification methods:

    • Yeast two-hybrid screening

    • Co-immunoprecipitation followed by mass spectrometry

    • Protein microarray screening

    • Comparative proteomics between wild-type and RMA1 overexpression/knockout lines

  • Validation methods:

    • In vitro ubiquitination assays with purified candidate substrates

    • In vivo ubiquitination assays using co-expression in plant cells

    • Proteasome inhibitor experiments (e.g., MG132 treatment) to detect substrate stabilization

    • Analysis of substrate protein levels in RMA1 mutant backgrounds

Research has successfully identified PIP2;1 (an Arabidopsis aquaporin) as a substrate of RMA1 using these approaches. Experimental evidence showed that RMA1 interacts with PIP2;1 in vitro and ubiquitinates it in vivo. Moreover, RMA1 overexpression reduced PIP2;1 levels, and this reduction was inhibited by the proteasome inhibitor MG132, confirming the role of RMA1 in the ubiquitin-proteasome-mediated degradation of PIP2;1 .

What genetic approaches are most effective for studying RMA1 function in planta?

Several genetic approaches have proved valuable for studying RMA1 function:

  • Overexpression studies:

    • Constitutive overexpression under 35S promoter

    • Inducible overexpression systems

    • Tissue-specific overexpression

  • Loss-of-function approaches:

    • T-DNA insertional mutants

    • RNAi-mediated knockdown

    • CRISPR/Cas9 gene editing

  • Combinatorial genetic approaches:

    • Double/triple mutant analysis with related genes (e.g., RMA1/RMA2/RMA3)

    • Crossing with substrate mutants to analyze genetic interactions

Studies have shown that single mutants in RMA genes often show subtle or no phenotypes due to functional redundancy. For example, analysis of ask1 ask2 double mutants revealed embryonic defects not seen in either single mutant, suggesting that similar approaches may be needed for comprehensive analysis of RMA family functions . Overexpression of RMA1H1 (a hot pepper homolog) in Arabidopsis conferred enhanced tolerance to drought stress, demonstrating the utility of heterologous expression for functional studies .

How does RMA1 regulate plant stress responses, particularly drought tolerance?

RMA1 and its homologs play significant roles in plant stress responses, particularly drought tolerance, through multiple mechanisms:

  • Regulation of aquaporin trafficking and turnover:

    • RMA1H1 (a hot pepper homolog) inhibits trafficking of PIP2;1 from the ER to the plasma membrane

    • It promotes ubiquitination and proteasomal degradation of PIP2;1

    • This reduces water loss through regulation of water channel proteins

  • Stress-responsive gene expression:

    • RMA1H1 is rapidly induced by various abiotic stresses, including dehydration

    • Overexpression of RMA1H1 in Arabidopsis conferred strongly enhanced tolerance to drought stress

  • Phenotypic effects:

    • Arabidopsis plants overexpressing RMA1H1 show improved survival under severe water deficit conditions

    • These plants exhibit drought avoidance through reduced water loss rather than drought tolerance

The regulatory mechanism appears to involve quality control of membrane proteins at the ER level, with RMA1 helping to prevent excess water loss by controlling the abundance of specific aquaporins . This represents an important post-translational regulatory mechanism for plant adaptation to environmental stresses.

What is the relationship between RMA1 and other components of the ubiquitination pathway in plants?

RMA1 functions within a complex network of ubiquitination pathway components:

ComponentRelationship with RMA1Functional Significance
E1 (Ubiquitin-activating enzyme)Provides activated ubiquitin for the ubiquitination cascadeArabidopsis has 2 isoforms of E1 that can work with RMA1
E2 (Ubiquitin-conjugating enzymes)RMA1 specifically interacts with UBC4/UBC5-type E2sFrom 37 predicted E2s in Arabidopsis, only specific ones function with RMA1
Other E3 ligasesMay have overlapping or complementary functions with RMA1Arabidopsis genome encodes >1,300 E3 ligase components
26S proteasomeDegrades RMA1-ubiquitinated substratesInhibition by MG132 stabilizes RMA1 substrates

RMA1 represents just one of approximately 469 predicted RING domain-containing proteins in Arabidopsis, highlighting the complexity and specificity of the plant ubiquitination system . The selective interaction with UBC4/UBC5-type E2 enzymes (but not with E2-20k, E2-25k, Ubc3, or Ubc8) demonstrates the specificity within the ubiquitination cascade . This selective E2-E3 pairing may be crucial for determining substrate specificity and the type of ubiquitin chain linkages formed.

How do the different RMA family members (RMA1, RMA2, RMA3) differ in function and substrate specificity?

The RMA family in Arabidopsis consists of three members with distinct yet potentially overlapping functions:

PropertyRMA1RMA2RMA3
Sequence identityReference30% identity to RMA129% identity to RMA1
LocalizationER membraneER membraneER membrane
E3 ligase activityConfirmedConfirmedConfirmed
Known substratesPIP2;1Less characterizedLess characterized
Functional redundancyPartialPartialPartial

Given the phenotypic subtlety of single mutants in many E3 ligase families, comprehensive analysis of RMA function likely requires generation and characterization of double or triple mutants, similar to approaches used for other gene families like ASK1/ASK2 .

How conserved is RMA1 across plant species and what does this reveal about its evolutionary importance?

RMA1 shows significant conservation across plant species, with homologs identified in diverse plants:

  • Cross-species comparison:

    • Arabidopsis thaliana: RMA1, RMA2, RMA3

    • Capsicum annuum (hot pepper): Rma1H1 (shares homology with Arabidopsis RMA1)

    • Oryza sativa (rice): RING proteins with ~29% identity to RMA1

    • Remarkably, RMA1 even shows ~22% sequence identity with human RING membrane-anchor 1 protein (Hs-Rma1)

  • Domain conservation:

    • The RING domain shows 57-73% identity across plant RING proteins

    • The C-terminal membrane-spanning domain is also conserved

    • These conserved features suggest evolutionary pressure to maintain both the catalytic and localization properties

The functional conservation is demonstrated by the fact that hot pepper Rma1H1 can function properly when expressed in Arabidopsis, conferring drought tolerance . This high degree of conservation across diverse plant species suggests that RMA1-like proteins play fundamental roles in plant cellular processes, particularly in quality control of membrane proteins and stress responses.

What are the key differences between plant and human RMA1 homologs?

Despite sharing only 22% sequence identity, plant and human RMA1 proteins share several functional similarities but also exhibit important differences:

FeaturePlant RMA1Human RMA1 (Hs-Rma1)
Structural domainsRING domain + C-terminal TM domainRING domain + C-terminal TM domain
Subcellular localizationER membraneER membrane
E2 enzyme preferenceFunctions with UBC4/5-type E2sFunctions with UBC4/5-type E2s
Known substratesPlant-specific (e.g., PIP2;1)Human-specific (involved in secretory pathway)
Physiological rolesDrought stress response, ER quality controlER-associated degradation, secretory pathway regulation

What are common challenges in expressing and purifying functional recombinant RMA1?

Researchers working with RMA1 face several technical challenges:

  • Expression challenges:

    • Membrane protein expression issues due to the C-terminal transmembrane domain

    • Potential toxicity when overexpressed in bacterial systems

    • Proper folding of the RING domain, which requires correct zinc coordination

  • Purification challenges:

    • Solubility issues due to the hydrophobic membrane domain

    • Maintaining enzymatic activity during purification

    • Preventing aggregation and precipitation

  • Recommended solutions:

    • Use of fusion tags (MBP, GST) to improve solubility

    • Expression of truncated versions lacking the transmembrane domain for some applications

    • Addition of zinc during purification to maintain RING domain structure

    • Use of mild detergents for solubilization of full-length protein

    • Low-temperature induction to improve proper folding

The most successful approach for functional studies has been expressing RMA1 as an MBP fusion protein, which can be used directly in in vitro ubiquitination assays . For studies requiring the full-length membrane-integrated protein, plant-based expression systems or careful detergent extraction from bacterial membranes is recommended.

How can researchers distinguish between direct and indirect effects when studying RMA1 overexpression phenotypes?

Distinguishing direct from indirect effects is a common challenge in RMA1 research:

  • Complementary approaches:

    • Combine overexpression with loss-of-function studies

    • Use inducible expression systems to capture immediate responses

    • Conduct time-course experiments to separate early (likely direct) from late (possibly indirect) effects

  • Substrate validation methods:

    • In vitro ubiquitination assays with purified components

    • Co-immunoprecipitation to confirm physical interaction

    • Site-directed mutagenesis of potential ubiquitination sites on substrates

    • Use of catalytically inactive RMA1 variants as controls

  • Controls for phenotypic analysis:

    • Expression of catalytically inactive RMA1 (RING domain mutants)

    • Expression of other RING E3 ligases to test for specificity

    • Combined treatment with proteasome inhibitors

For example, research on PIP2;1 as an RMA1 substrate employed multiple approaches: showing direct interaction in vitro, demonstrating in vivo ubiquitination, observing reduced protein levels upon RMA1 overexpression, and confirming the role of the proteasome by MG132 treatment . This multi-faceted approach provides strong evidence for direct rather than indirect effects.

What are the best experimental designs for studying RMA1 function in drought stress responses?

Optimal experimental designs for studying RMA1's role in drought stress include:

  • Genetic materials:

    • RMA1 overexpression lines

    • rma1 single and combined mutants with rma2/rma3

    • Inducible expression systems

    • Tissue-specific expression lines

  • Drought stress protocols:

    • Progressive drought (water withholding)

    • Controlled soil water potential methods

    • Osmotic stress using PEG or mannitol

    • Short-term dehydration assays

    • Recovery assessment after re-watering

  • Physiological measurements:

    • Survival rate

    • Relative water content

    • Stomatal conductance

    • Transpiration rate

    • Photosynthetic efficiency (Fv/Fm)

    • Abscisic acid (ABA) levels and response

  • Molecular analyses:

    • Aquaporin trafficking (using fluorescently tagged PIP2;1)

    • In vivo ubiquitination status of target proteins

    • RMA1 expression levels under stress conditions

    • Membrane protein composition analysis

Research has shown that RMA1H1 overexpression in Arabidopsis significantly improved drought tolerance, with transgenic plants showing better survival under severe water deficit conditions . Careful experimental design must include appropriate controls and consider the potential effects of growth conditions, plant developmental stage, and the intensity and duration of stress application.

What emerging technologies could advance our understanding of RMA1 function in plants?

Several cutting-edge technologies hold promise for deepening our understanding of RMA1:

  • Proximity labeling approaches:

    • BioID or TurboID fusion proteins to identify proteins in the vicinity of RMA1

    • Allows identification of transient interactors and substrate candidates

  • Advanced imaging techniques:

    • Super-resolution microscopy to precisely localize RMA1 within ER subdomains

    • FRET-based sensors to monitor ubiquitination events in real-time

    • Single-molecule tracking to follow RMA1-mediated protein degradation

  • Multi-omics integration:

    • Combining proteomics, transcriptomics, and metabolomics in RMA1 mutant backgrounds

    • Network analysis to place RMA1 in broader cellular pathways

  • Structural biology approaches:

    • Cryo-EM structures of RMA1 alone and in complex with E2s and substrates

    • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

These advanced technologies could help resolve outstanding questions about RMA1's substrate specificity, regulatory mechanisms, and integration with other cellular stress response pathways.

How might understanding RMA1 function contribute to improving crop stress tolerance?

The potential applications of RMA1 research for crop improvement include:

  • Transgenic approaches:

    • Overexpression of RMA1 or its homologs in crops to enhance drought tolerance

    • Fine-tuned expression using stress-inducible or tissue-specific promoters

    • Engineering of optimized RMA1 variants with enhanced activity or stability

  • Marker-assisted breeding:

    • Identification of natural variants in RMA1 and its homologs associated with stress tolerance

    • Development of molecular markers for these variants

    • Integration into breeding programs for drought-resistant crops

  • Target substrate engineering:

    • Modification of RMA1 substrates like aquaporins to alter their regulation

    • Engineering substrate proteins to escape or enhance RMA1-mediated regulation

  • Pathway integration:

    • Combining RMA1-based approaches with other stress tolerance mechanisms

    • Creating crops with multiple layered protection against drought

Research has demonstrated that even single-gene manipulations of RMA1 homologs can significantly improve drought tolerance, as shown with RMA1H1 overexpression in Arabidopsis . This suggests that similar approaches could be valuable for improving stress tolerance in crops, particularly in the context of climate change and increased water scarcity in agricultural systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.