Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase RMA3 (RMA3)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase RMA3 (RMA3) is an enzyme that functions as an E3 ubiquitin ligase . RMA1, RMA2, and RMA3 all exhibit E3 ubiquitin ligase activity and are located in the endoplasmic reticulum (ER) .

Arabidopsis thaliana, commonly known as Arabidopsis, is a widely used model organism in plant biology . The study of Arabidopsis thaliana has provided substantial insights into various biological processes, including RNA interference and epigenetic regulation .

Function and Activity

RMA3 functions as an E3 ubiquitin ligase, which is involved in the ubiquitination pathway . Ubiquitination is a process that involves the attachment of ubiquitin to a substrate protein, marking it for degradation or altering its function.

Localization

RMA3, along with RMA1 and RMA2, is localized to the endoplasmic reticulum (ER) . The ER is an important cellular organelle involved in protein processing and folding . Proteins located in the ER can play roles in response to aluminum (Al) tolerance mechanisms .

Homology and Expression

RMA1H1 shares sequence identity with Arabidopsis Rma2 (30% identity) and Rma3 (29% identity) . In Arabidopsis, a green fluorescent protein (GFP)-tagged form of Rma1H1, 35S:GFP-Rma1H1, introduced into Arabidopsis protoplasts prepared from leaf tissues, displayed a network pattern, similar to ER-localized proteins .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery timelines.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
RMA3; At4g27470; F27G19.70; E3 ubiquitin-protein ligase RMA3; Protein RING membrane-anchor 3; RING-type E3 ubiquitin transferase RMA3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-243
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
RMA3
Target Protein Sequence
MEGNFFIRSDAQRAHDNGFIAKQKPNLTTAPTAGQANESGCFDCNICLDTAHDPVVTLCGHLFCWPCIYKWLHVQLSSVSVDQHQNNCPVCKSNITITSLVPLYGRGMSSPSSTFGSKKQDALSTDIPRRPAPSALRNPITSASSLNPSLQHQTLSPSFHNHQYSPRGFTTTESTDLANAVMMSFLYPVIGMFGDLVYTRIFGTFTNTIAQPYQSQRMMQREKSLNRVSIFFLCCIILCLLLF
Uniprot No.

Target Background

Function
E3 ubiquitin-protein ligase.
Gene References Into Functions
  1. RMA1, RMA2, and RMA3 exhibit E3 ubiquitin ligase activity and are localized to the endoplasmic reticulum. [RMA3] PMID: 19224217
Database Links

KEGG: ath:AT4G27470

STRING: 3702.AT4G27470.1

UniGene: At.43903

Subcellular Location
Endoplasmic reticulum membrane; Single-pass type IV membrane protein.
Tissue Specificity
Ubiquitous. Highly expressed in roots.

Q&A

What is RMA3 and what is its functional classification in Arabidopsis thaliana?

RMA3 (Uniprot ID: Q8GUK7) is an E3 ubiquitin ligase in Arabidopsis thaliana that belongs to the ubiquitination pathway responsible for targeted protein degradation. E3 ubiquitin ligases represent the final step in a three-enzyme cascade (E1-E2-E3) that attaches ubiquitin to target proteins, marking them for degradation by the 26S proteasome. This post-translational modification system is crucial for regulating protein expression levels and activity beyond transcriptional/translational control. RMA3 specifically belongs to the RING-finger type E3 ligases, which facilitate the direct transfer of ubiquitin from an E2 enzyme to the target protein without forming an intermediate thioester bond with ubiquitin .

How does RMA3 fit into the broader E3 ubiquitin ligase family in plants?

The E3 ubiquitin ligase family in Arabidopsis thaliana is remarkably extensive, comprising approximately 5% of the genome with over 1,000 predicted members. This large gene family provides specificity to the ubiquitination system, with each E3 ligase targeting particular proteins for degradation. RMA3 likely belongs to the RING-finger subclass, which represents the largest group with approximately 499 members in Arabidopsis . The RING-finger E3 ligases are characterized by a specialized zinc-binding domain that mediates interactions with E2 enzymes and facilitates ubiquitin transfer. Within this classification, RMA3 may fit into specific subfamilies determined by sequence similarity and domain architecture, though the precise categorization would require detailed sequence analysis beyond the provided search results.

What structural domains characterize RMA3 and how do they contribute to its function?

Like other RING-finger E3 ubiquitin ligases, RMA3 likely contains a characteristic RING domain that coordinates zinc ions through a defined pattern of cysteine and histidine residues. This domain is essential for interaction with E2 conjugating enzymes and for catalyzing the transfer of ubiquitin to target substrates. Based on patterns observed in other plant E3 ligases, RMA3 may contain additional domains that mediate protein-protein interactions or substrate recognition. These could include transmembrane domains, coiled-coil regions, or other protein-interaction motifs that determine its subcellular localization and specific target recognition capabilities . The complete structural characterization would require detailed analysis of the protein sequence and experimental validation through structural biology approaches.

What are the tissue-specific and developmental expression patterns of RMA3?

While the search results don't provide specific information about RMA3 expression patterns, understanding the spatial and temporal expression of E3 ubiquitin ligases is critical for inferring their biological functions. To determine RMA3 expression patterns, researchers typically analyze publicly available microarray or RNA-seq datasets, use quantitative RT-PCR across different tissues and developmental stages, or generate transgenic plants expressing RMA3 promoter-reporter gene fusions. E3 ubiquitin ligases in Arabidopsis often show tissue-specific or condition-dependent expression patterns that correlate with their biological roles, whether in development, stress responses, or hormone signaling .

How is RMA3 activity regulated at the post-translational level?

E3 ubiquitin ligases themselves are frequently subject to post-translational regulation, creating additional layers of control. Potential regulatory mechanisms for RMA3 might include:

  • Phosphorylation by specific kinases that modify its activity or substrate specificity

  • Self-ubiquitination leading to auto-regulation through degradation

  • Protein-protein interactions that modulate its ligase activity

  • Subcellular compartmentalization that controls access to substrates

  • Redox-dependent modifications affecting the RING domain structure

Experimental approaches to investigate these mechanisms could involve mass spectrometry to identify post-translational modifications, yeast two-hybrid or co-immunoprecipitation to detect regulatory protein partners, and mutational analyses of potential regulatory sites .

What are the optimal conditions for storing and handling recombinant RMA3?

According to the product information for commercially available recombinant RMA3, the protein should be stored at -20°C for general storage, and at -80°C for extended preservation. Working aliquots can be maintained at 4°C for up to one week. The protein is typically supplied in a Tris-based buffer with 50% glycerol that has been optimized for stability . Repeated freeze-thaw cycles should be avoided as they can compromise protein integrity and activity. For experimental work, researchers should consider buffer conditions that maintain the native conformation and enzymatic activity of the protein, potentially including reducing agents to protect cysteine residues in the RING domain.

How can I design experiments to identify novel substrates of RMA3?

Identifying E3 ubiquitin ligase substrates is challenging but can be approached through several complementary strategies:

  • Yeast two-hybrid screens: Using RMA3 as bait to identify interacting proteins from an Arabidopsis cDNA library

  • Co-immunoprecipitation coupled with mass spectrometry: Pulling down RMA3 protein complexes from plant tissues followed by identification of associated proteins

  • Protein microarray screening: Testing RMA3-dependent ubiquitination activity against arrays of potential substrate proteins

  • Comparative proteomics: Comparing protein abundance in wild-type versus RMA3 overexpression or knockout lines, particularly focusing on proteins that show altered stability

  • In vitro ubiquitination assays: Validating potential substrates through reconstituted ubiquitination reactions with purified components

These approaches should be combined with validation experiments, such as confirming direct interaction, demonstrating ubiquitination in vitro and in vivo, and showing altered stability of the substrate in response to RMA3 manipulation .

What expression systems are most effective for producing functional recombinant RMA3?

While the search results don't specify the optimal expression system for RMA3 specifically, several systems are commonly used for producing plant E3 ubiquitin ligases:

  • E. coli: Offers high yield but may lack proper folding or post-translational modifications

  • Insect cells: Better suited for more complex eukaryotic proteins with proper folding requirements

  • Yeast: Provides a eukaryotic environment with relatively high yield

  • Plant expression systems: Ensures proper folding and modification in the native context

For functional studies of E3 ubiquitin ligases, the expression system should preserve the integrity of the RING domain, which typically requires proper zinc coordination. This may necessitate supplementation with zinc during expression and purification. Additionally, co-expression with chaperones may improve folding and solubility. The choice of tags (His, GST, MBP) can significantly impact solubility and activity, with the tag location (N- or C-terminal) potentially affecting function based on the protein's specific domain architecture .

How does RMA3 participate in specific signaling pathways in Arabidopsis?

E3 ubiquitin ligases in Arabidopsis play critical roles in various signaling pathways by regulating the stability and abundance of key signaling components. While specific information about RMA3's role is not provided in the search results, E3 ligases in Arabidopsis are known to function in hormone signaling (auxin, jasmonic acid, ethylene, abscisic acid, gibberellin), light responses, stress responses, and developmental processes .

To determine RMA3's involvement in specific signaling pathways, researchers could:

  • Analyze phenotypes of RMA3 knockout or overexpression lines under various conditions

  • Perform epistasis analysis with known signaling pathway mutants

  • Examine changes in known signaling components' abundance in RMA3 mutant backgrounds

  • Investigate transcriptional responses to specific stimuli in wild-type versus RMA3 mutant plants

These approaches would help place RMA3 within the complex network of plant signaling pathways.

What are the phenotypic consequences of RMA3 knockout or overexpression?

Altering the expression levels of E3 ubiquitin ligases often results in observable phenotypes that provide insights into their biological functions. For many E3 ligases in Arabidopsis, knockout mutations can lead to embryo lethality, suggesting essential roles in development, as observed for several ATL-RING gene disruptions . In non-lethal cases, phenotypes might manifest in specific developmental processes, stress responses, or hormone sensitivities.

To assess RMA3 function through genetic approaches, researchers could:

  • Generate knockout lines using T-DNA insertion or CRISPR-Cas9 genome editing

  • Create overexpression lines using constitutive or inducible promoters

  • Develop tissue-specific or condition-specific expression systems

  • Analyze phenotypes under both standard growth conditions and various stresses

Comprehensive phenotyping would include examining growth parameters, developmental timing, morphological characteristics, and responses to biotic and abiotic stresses.

How can I measure the enzymatic activity of recombinant RMA3 in vitro?

The enzymatic activity of E3 ubiquitin ligases can be assessed through in vitro ubiquitination assays using purified components. A typical assay includes:

ComponentFunctionSource/Preparation
Recombinant RMA3E3 ubiquitin ligasePurified from expression system
E1 enzymeUbiquitin activationCommercial or recombinant
E2 enzymeUbiquitin conjugationSeveral UBC family members may need to be tested
UbiquitinSubstrate for conjugationCommercial or recombinant, may be tagged for detection
ATPEnergy sourceHigh purity ATP solution
Target substrateProtein for ubiquitinationPurified potential substrate protein
Buffer componentsReaction environmentTypically includes Tris, MgCl₂, DTT at optimized pH

The reaction products can be analyzed by SDS-PAGE followed by western blotting using antibodies against ubiquitin or the substrate protein. Successful ubiquitination is indicated by the appearance of higher molecular weight bands representing mono- or poly-ubiquitinated forms of the substrate. For RMA3 specifically, researchers might need to test multiple E2 enzymes, as E3 ligases often show preference for specific E2 partners .

What are the most efficient approaches for identifying the E2 enzyme partners of RMA3?

E3 ubiquitin ligases typically work with specific E2 conjugating enzymes to catalyze ubiquitin transfer. Identifying the correct E2 partners for RMA3 is crucial for understanding its functional mechanism. Approaches include:

  • In vitro E2 screening: Testing RMA3 activity with a panel of recombinant Arabidopsis E2 enzymes in ubiquitination assays

  • Yeast two-hybrid assays: Screening for direct interactions between RMA3 and various E2 enzymes

  • In vivo co-immunoprecipitation: Identifying E2 enzymes that associate with RMA3 in plant tissues

  • Bimolecular fluorescence complementation: Visualizing RMA3-E2 interactions in plant cells

Based on patterns observed with other plant RING-finger E3 ligases, RMA3 might preferentially interact with members of the UBC8 family of E2 enzymes, which are frequently partnered with plant RING E3 ligases .

How does protein structure influence RMA3 substrate recognition specificity?

The substrate recognition specificity of E3 ubiquitin ligases is critical for their biological function. For RING-finger E3 ligases like RMA3, substrate recognition typically involves domains outside the RING motif. Structural determinants may include:

  • Recognition motifs: Specific amino acid sequences or structural elements in substrates

  • Accessory domains: Additional protein domains in RMA3 that mediate substrate binding

  • Post-translational modifications: Phosphorylation or other modifications of substrates that create binding sites

  • Adaptor proteins: Additional proteins that bridge RMA3 and its substrates

Advanced research approaches to understand these mechanisms include:

  • Structural biology techniques (X-ray crystallography, cryo-EM) to resolve RMA3-substrate complexes

  • Mutagenesis of potential substrate-binding regions

  • Peptide array screening to identify minimal recognition motifs

  • Computational modeling of protein-protein interactions

Understanding the structural basis of RMA3's substrate specificity would provide insights into its biological function and potential applications in manipulating protein stability in plants .

How does RMA3 compare functionally to other characterized E3 ubiquitin ligases in Arabidopsis?

Arabidopsis contains a diverse array of E3 ubiquitin ligases with specialized functions. Based on the information available about other characterized E3 ligases, we can establish a comparative framework for understanding RMA3:

E3 LigaseTypeBiological FunctionTarget ProteinsComparison Point
COP1RING-HCaPhotomorphogenesis regulationHY5, HYH, LAF1, cry2, phyAMulti-domain structure with WD40 repeats for target recognition
TIR1F-boxAuxin receptorIAA/Aux proteinsSubstrate recognition through hormone co-receptor mechanism
AIP2RING-H2ABA signalingABI3Uses UBC8, 10, 11, 28, 29, 30 as E2 partners
SINAT5RING-HCaAuxin signalingNAC1Uses AtUBC9a as E2 partner
HOS1incomplete RINGCold stress responseICE1Uses UBC8 as E2 partner

This comparative analysis highlights the diversity of biological processes regulated by E3 ligases and various mechanisms of substrate recognition. Understanding where RMA3 fits within this framework requires experimental characterization of its substrates, E2 partners, and biological functions .

Are there RMA3 homologs in other plant species and how are they functionally conserved?

E3 ubiquitin ligases often show evolutionary conservation across plant species, though with potential functional divergence. To identify and characterize RMA3 homologs in other plants, researchers could:

  • Perform phylogenetic analyses using the RMA3 protein sequence against other plant genomes

  • Compare expression patterns of homologous genes in different species

  • Conduct functional complementation experiments to test cross-species activity

  • Analyze the conservation of key domains and putative substrate recognition motifs

Understanding the evolutionary conservation of RMA3 would provide insights into its fundamental importance in plant biology and potentially identify species-specific adaptations in the ubiquitination pathway. This comparative approach could also help identify conserved substrates and regulatory mechanisms that have been maintained throughout plant evolution.

How can engineered variants of RMA3 be used as research tools?

Engineered variants of E3 ubiquitin ligases can serve as valuable research tools for studying protein degradation and cellular processes. Potential applications for modified RMA3 include:

  • Substrate-trapping mutants: Catalytically inactive variants that bind but don't ubiquitinate substrates, useful for identifying new targets

  • Chimeric E3 ligases: Fusion proteins combining RMA3's catalytic domain with alternative substrate-binding domains to create novel specificity

  • Inducible degradation systems: Engineered RMA3-based systems that allow for controlled degradation of specific proteins upon application of a chemical trigger

  • Fluorescent protein fusions: Tools for visualizing RMA3 localization and dynamics in living plant cells

These engineered variants require careful design based on structural knowledge and functional domains. Mutations in the RING domain that disrupt E2 binding but maintain substrate interactions are particularly useful for creating substrate traps that can help identify the natural targets of RMA3 .

What are the optimal conditions for conducting in vitro ubiquitination assays with recombinant RMA3?

In vitro ubiquitination assays with recombinant E3 ubiquitin ligases require optimization of several parameters to achieve robust activity. Based on protocols established for other plant E3 ligases, the following conditions might be optimal for RMA3:

ParameterRecommended ConditionConsideration
Temperature25-30°CPlant proteins often show optimal activity at temperatures lower than mammalian systems
pH7.5-8.0Slightly alkaline conditions typically favor ubiquitination reactions
BufferTris-HCl (50 mM)Common buffer that maintains stable pH in the appropriate range
SaltNaCl (50-150 mM)Moderate ionic strength to support protein interactions without disruption
Reducing agentDTT (0.5-1 mM)Maintains cysteine residues in reduced state for proper RING domain function
CofactorsMgCl₂ (5 mM), ATP (2-5 mM)Essential for E1 enzyme function and ubiquitin activation
Reaction time1-2 hoursSufficient time for multi-step reaction while minimizing protein degradation
E2 enzymeUBC8 family membersBased on common E2 partners for plant RING E3 ligases

These conditions would need to be empirically optimized for RMA3 specifically, as each E3 ligase may have unique requirements for optimal activity. The choice of E2 enzyme is particularly critical and may require screening multiple options to identify the most efficient partner .

What emerging technologies could advance our understanding of RMA3 function?

Several cutting-edge technologies could significantly enhance our understanding of RMA3 function in the coming years:

  • Proximity-dependent labeling (BioID, TurboID): These approaches can identify proteins in close proximity to RMA3 in living cells, potentially revealing both substrates and regulatory partners

  • Single-molecule techniques: Methods like single-molecule FRET could provide insights into the dynamics of RMA3-substrate interactions and conformational changes during the ubiquitination process

  • Cryo-electron microscopy: Advances in cryo-EM could enable structural determination of RMA3 in complex with E2 enzymes and substrates at near-atomic resolution

  • Quantitative ubiquitinomics: Mass spectrometry-based approaches to globally profile ubiquitination sites and dynamics in response to RMA3 manipulation

  • Optogenetic control: Light-controlled activation or inhibition of RMA3 function to study temporal aspects of its activity

These technologies would complement traditional genetic and biochemical approaches, providing a more comprehensive understanding of RMA3's molecular mechanisms and biological functions.

What are the potential applications of understanding RMA3 function for plant biotechnology?

Understanding the function of E3 ubiquitin ligases like RMA3 has significant implications for plant biotechnology:

  • Engineered protein stability: Manipulating RMA3 could allow for controlled regulation of specific protein levels in transgenic plants

  • Stress resistance engineering: If RMA3 is involved in stress responses, modifying its activity or expression could enhance plant resilience to environmental challenges

  • Developmental control: Targeted degradation of key regulatory proteins could provide new tools for controlling flowering time, senescence, or other developmental transitions

  • Hormone sensitivity modulation: Many E3 ligases regulate hormone signaling components, offering opportunities to fine-tune hormone responses in crops

  • Synthetic biology applications: RMA3-based degradation modules could be incorporated into synthetic circuits for complex response patterns in plants

These applications would require detailed understanding of RMA3's natural substrates, regulation, and the consequences of its manipulation in different plant tissues and developmental stages.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.