Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase SDIR1 (SDIR1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Arabidopsis thaliana E3 Ubiquitin-Protein Ligase SDIR1 (SDIR1)

Arabidopsis thaliana E3 ubiquitin-protein ligase SDIR1 (SDIR1), is a RING finger E3 ligase that participates in abscisic acid (ABA)-related stress signal transduction in Arabidopsis thaliana . SDIR1 is expressed throughout Arabidopsis tissues and upregulated by drought and salt stress, but not by ABA. It acts as a positive regulator of ABA signaling .

Functional Studies and Research Findings

  • E3 Ubiquitin Ligase Activity SDIR1 functions as an E3 ubiquitin ligase, which is required for its activity . It interacts with and ubiquitinates its substrate, SDIR1-INTERACTING PROTEIN1 (SDIRIP1), modulating SDIRIP1 stability through the 26S proteasome pathway . A mutated version of SDIR1, SDIM (with a His-234 to Tyr-234 substitution), can block its E3 ligase activity without affecting substrate interaction .

  • Regulation of Stress Responses SDIR1 positively regulates stress-responsive ABA signaling . Plants overexpressing SDIR1 exhibit ABA hypersensitivity and associated phenotypes, such as salt hypersensitivity during germination, enhanced ABA-induced stomatal closing, and improved drought tolerance .

  • Interaction with SDIRIP1 SDIR1 interacts with SDIRIP1, which acts genetically downstream of SDIR1 in ABA and salt stress signaling . The SDIR1/SDIRIP1 complex regulates ABA-mediated seed germination and plant salt response .

  • Role in Ethylene Signaling SDIR1 destabilizes ethylene insensitive 3 (EIN3)-binding F-box protein 1 and 2 (EBF1/EBF2), thereby participating in ethylene signaling . SDIR1 physically interacts with EBF1 and EBF2, and its E3 ligase activity is necessary for its function in ethylene signaling .

  • Involvement in Plant Immunity SDIR1 is a susceptibility factor in plant immunity and enhances disease caused by P. syringae pv. tomato DC3000 in Arabidopsis . It modulates JA and ABA signaling gene expression in response to P. syringae pv. tomato DC3000 infection . Loss of SDIR1 or its target protein SDIRP1 improves plant defense response .

Genetic and Mutant Studies

  • T-DNA Insertion Mutants Two T-DNA insertion lines, sdir1-1 (SALK_052702) and sdir1-2 (SALK_114361), have been identified as loss-of-function mutants for the SDIR1 gene .

  • sdir1 Mutant Phenotypes The sdir1 mutants and RNAi lines exhibit partial resistance against P. syringae pv. tomato DC3000 . The inhibitory effect of coronatine (COR) on root growth and elongation is not observed in sdir1 mutants, similar to JAZ9 overexpression (JAZ9-OE) and coi1 mutant lines .

SDIR1 and ABA Signaling

  • Regulation of ABA Marker Genes Expression levels of key ABA and stress marker genes are altered in both SDIR1 overexpression and sdir1-1 mutant plants .

  • Upstream Regulation SDIR1 acts upstream of basic leucine zipper family genes such as ABA-INSENSITIVE5 (ABI5), ABRE BINDING FACTOR3 (ABF3), and ABF4 . While ABF3 and ABF4 genes can rescue the ABA-insensitive phenotype of the sdir1-1 mutant, SDIR1 cannot rescue the abi5-1 mutant .

  • SDIR1 and SDIRIP1 in ABA Pathway SDIR1 acts upstream of transcription factors ABF4 and ABI5 in the ABA pathway, with SDIRIP1 acting intermediately between these transcription factors .

SDIR1 in Other Plant Species

  • Wheat A RING finger ubiquitin E3 ligase gene, TaSDIR1-4A, contributes to drought resistance in wheat .

  • Orthologs SDIR1 has orthologs in other plant species, suggesting a conserved role in stress responses and hormone signaling .

Table 1: Effects of SDIR1 Overexpression and Mutation on ABA-Related Phenotypes

PhenotypeSDIR1 Overexpressionsdir1 Mutant
ABA SensitivityHypersensitiveInsensitive
Salt HypersensitivityEnhancedReduced
Stomatal Closing (ABA-induced)EnhancedReduced
Drought ToleranceEnhancedReduced

Table 2: SDIR1 Interacting Proteins and Their Functions

ProteinFunction
SDIRIP1Modulates SDIRIP1 stability through the 26S proteasome pathway; regulates ABA-mediated seed germination and plant salt response .
EBF1/EBF2Destabilized by SDIR1; involved in ethylene signaling .
ABI5Transcription factor in the ABA signaling pathway; SDIR1 acts upstream .
ABF3/ABF4Transcription factors in the ABA signaling pathway; can rescue the ABA-insensitive phenotype of the sdir1-1 mutant; SDIR1 acts upstream .

Table 3: Microarray Analysis of Differentially Expressed Genes (DEGs) in SDIR1-OE and sdir1 Mutant Lines Compared to Col-0 After Pathogen Inoculation

SDIR1-OE Linesdir1 Mutant Line
Upregulated Genes46 genes showed higher transcript levels compared to wild-type Col-0 10 genes showed higher transcript levels compared to wild-type Col-0
Downregulated Genes11 genes showed lower transcript levels compared to wild-type Col-0 76 genes showed lower transcript levels compared to wild-type Col-0

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your required tag type for preferential development.
Synonyms
SDIR1; At3g55530; T22E16.190; E3 ubiquitin-protein ligase SDIR1; Protein SALT- AND DROUGHT-INDUCED RING FINGER 1; RING-type E3 ubiquitin transferase SDIR1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-273
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
SDIR1
Target Protein Sequence
MSFVFRGSRGDLESGFSGGFLPERRAMRVHGARPVNSNSLAFLVTVLLLFMILNSHQMPP NFLLWLVLGVFLMATTLRMYATCQQLQAHAQAQAAAASGLFSHTELRLHVPPSIALATRG RLQGLRLQLALLDREFDDLDYETLRALDSDNVSTTSMSEEEINALPVHKYKVLDPENGCS LAKQASTSSSAEKMLDSANESKKGTEDELTCSVCLEQVTVGEIVRTLPCLHQFHAGCIDP WLRQQGTCPVCKFRAHSGWQEQDEIDDDASDMV
Uniprot No.

Target Background

Function
Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase SDIR1 (SALT- AND DROUGHT-INDUCED RING FINGER1) is a positive regulator of abscisic acid (ABA)-dependent stress signal transduction. It interacts with and ubiquitinates ATP1/SDIRIP1, modulating its stability via the 26S proteasome pathway. SDIR1 negatively regulates ATP1/SDIRIP1 stability, thereby influencing ABA and salt stress responses. The SDIR1-ATP1/SDIRIP1 complex plays a crucial role in ABA signaling through ubiquitination.
Gene References Into Functions
  1. SDIR1 functions as a positive regulator in the ABA-dependent stress signaling pathway. [SDIR1] PMID: 17573536
  2. SDIR1 serves as a drought-tolerance gene in dicots and monocots, representing a potential candidate gene for drought-tolerance engineering in crops. PMID: 18685183
Database Links

KEGG: ath:AT3G55530

STRING: 3702.AT3G55530.1

UniGene: At.28462

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitous.

Q&A

What is SDIR1 and what is its functional role in Arabidopsis thaliana?

SDIR1 (At3g55530) is a C3H2C3 RING finger protein that functions as an E3 ubiquitin ligase in Arabidopsis thaliana. It plays a critical role in ABA-related stress signal transduction pathways. SDIR1 is expressed in all tissues of Arabidopsis and is significantly upregulated by drought and salt stress conditions, though interestingly not by ABA treatment directly . The protein acts as a positive regulator of ABA signaling, with overexpression leading to ABA hypersensitivity and ABA-associated phenotypes, including enhanced drought tolerance and salt hypersensitivity during germination .

The functional importance of SDIR1 is demonstrated through its ability to positively regulate stress responses by modulating the stability of its target proteins through ubiquitination. SDIR1 interacts with and ubiquitinates SDIRIP1 (SDIR1-INTERACTING PROTEIN1), targeting it for degradation via the 26S proteasome pathway . This regulatory mechanism affects downstream gene expression patterns, particularly those involved in ABA signaling.

What is the expression pattern of SDIR1 in response to various abiotic stresses?

SDIR1 exhibits distinct expression patterns in response to different abiotic stresses. RNA gel blot analysis has confirmed that SDIR1 transcript levels are significantly upregulated by drought and salt stress, but not by ABA treatment . During drought stress, SDIR1 expression increases approximately fivefold at the 12-hour point of treatment .

The expression pattern can be visualized using ProSDIR1-β-glucuronidase (GUS) reporter constructs, which have revealed strong induction of GUS expression specifically in stomatal guard cells and leaf mesophyll cells under drought stress conditions . This spatial regulation suggests a strategic role of SDIR1 in controlling water loss and maintaining cellular homeostasis during drought stress.

RT-PCR analysis has detected SDIR1 expression in all tissues of Arabidopsis, including leaves, stems, roots, siliques, and flowers, indicating its ubiquitous presence throughout plant development .

What is the subcellular localization of SDIR1?

SDIR1 is primarily localized to intracellular membranes, specifically the endoplasmic reticulum (ER) membrane in Arabidopsis thaliana . This localization has been confirmed through multiple experimental approaches:

  • Transient expression of GFP-SDIR1 fusion protein in Nicotiana benthamiana leaves and Arabidopsis leaf protoplasts shows green fluorescence in a net-like compartment resembling the ER .

  • Colocalization studies with the ER marker RFP-HDEL demonstrate that GFP-SDIR1 is located on the ER membrane, although localization to other intracellular membranes cannot be entirely excluded .

The membrane localization of SDIR1 likely facilitates its interactions with substrate proteins and other components of the ubiquitination machinery, positioning it strategically within the cell to regulate ABA signaling responses.

What is the molecular mechanism by which SDIR1 regulates ABA signaling?

SDIR1 regulates ABA signaling through a sophisticated ubiquitination-mediated pathway. As a RING finger E3 ligase, SDIR1 catalyzes the transfer of ubiquitin to specific substrate proteins, marking them for degradation via the 26S proteasome pathway . The primary identified substrate of SDIR1 is SDIRIP1 (SDIR1-INTERACTING PROTEIN1), which interacts directly with SDIR1 as demonstrated through in vitro pull-down assays and in planta coimmunoprecipitation .

The regulatory mechanism proceeds as follows:

  • SDIR1 directly interacts with SDIRIP1 at the endoplasmic reticulum membrane .

  • SDIR1 ubiquitinates SDIRIP1, targeting it for degradation through the 26S proteasome pathway .

  • SDIRIP1 acts as a negative regulator of ABA signaling by selectively controlling the expression of the downstream transcription factor ABI5 (ABA-INSENSITIVE5) .

  • By promoting SDIRIP1 degradation, SDIR1 relieves the repression on ABI5, allowing for enhanced ABA responses .

Cross-complementation experiments have revealed that ABI5, ABF3 (ABRE BINDING FACTOR3), and ABF4 genes can rescue the ABA-insensitive phenotype of the sdir1-1 mutant, whereas SDIR1 cannot rescue the abi5-1 mutant . This genetic evidence positions SDIR1 upstream of these basic leucine zipper family transcription factors in the ABA signaling cascade.

How can SDIR1 E3 ligase activity be experimentally validated in vitro?

SDIR1 E3 ligase activity can be experimentally validated through in vitro ubiquitination assays using the following methodology:

  • Protein expression and purification:

    • Express SDIR1 in E. coli as a fusion protein with maltose binding protein (MBP) tag.

    • Purify MBP-SDIR1 from the soluble fraction using affinity chromatography .

  • In vitro ubiquitination assay components:

    • Purified MBP-SDIR1 (E3 ligase)

    • Wheat (Triticum aestivum) E1 enzyme

    • Human E2 enzyme (UBCh5b)

    • His-tagged ubiquitin

    • ATP and buffer components

  • Detection methods:

    • Western blot analysis using nickel-horseradish peroxidase to detect His-ubiquitin

    • Anti-MBP antibodies to detect ubiquitination of the MBP-SDIR1 fusion protein

  • Controls:

    • Negative controls should include reactions lacking E1, E2, or ubiquitin

    • RING finger mutants of SDIR1 can serve as negative controls to demonstrate the requirement of the RING domain for ligase activity

For substrate-specific ubiquitination assays, SDIRIP1 can be expressed as a fusion protein with MYC and GST tags in E. coli and included in the reaction. Ubiquitination of SDIRIP1 can be detected using anti-MYC antibodies in western blot analysis .

What methodologies can be employed to study SDIR1-SDIRIP1 interactions?

The interaction between SDIR1 and its substrate SDIRIP1 can be studied using various complementary approaches:

  • In vitro pull-down assays:

    • Express MBP-SDIR1 in E. coli and purify using affinity chromatography

    • Generate [35S]Methionine-labeled SDIRIP1 through in vitro transcription and translation

    • Incubate MBP-SDIR1 with labeled SDIRIP1, with MBP alone as negative control

    • Analyze interactions by SDS-PAGE and autoradiography

  • Co-immunoprecipitation (Co-IP) in planta:

    • Transiently express 35S:GFP-SDIR1 and 35S:SDIRIP1-MYC in Nicotiana benthamiana leaves via agroinfiltration

    • Extract total proteins and immunoprecipitate using anti-GFP antibodies

    • Detect co-precipitated SDIRIP1-MYC using anti-MYC antibodies in western blot analysis

  • Bimolecular Fluorescence Complementation (BiFC):

    • Fuse SDIR1 and SDIRIP1 to complementary fragments of a fluorescent protein (e.g., YFP)

    • Co-express in plant cells and observe fluorescence reconstitution using confocal microscopy

    • Include appropriate negative controls to validate specific interactions

  • Subcellular co-localization:

    • Express fluorescently-tagged SDIR1 and SDIRIP1 in plant cells

    • Use confocal microscopy to examine co-localization patterns

    • Compare with appropriate organelle markers (e.g., RFP-HDEL for ER localization)

These approaches collectively provide robust evidence for physical interactions between SDIR1 and SDIRIP1 in both in vitro and in vivo contexts.

How do SDIR1 overexpression and knockout affect plant phenotypes and stress responses?

SDIR1 expression levels significantly impact plant phenotypes and stress responses, as demonstrated through both overexpression and knockout studies:

SDIR1 Overexpression Phenotypes:

  • ABA hypersensitivity during seed germination and early seedling development

  • Salt hypersensitivity during germination

  • Enhanced ABA-induced stomatal closure, leading to reduced water loss

  • Enhanced drought tolerance in mature plants

  • Altered expression patterns of key ABA and stress-responsive genes

SDIR1 Knockout Phenotypes (sdir1-1 and sdir1-2 mutants):

  • Longer primary roots compared to wild-type plants

  • ABA insensitivity during germination and early seedling development

  • Reduced sensitivity to salt stress

  • Decreased ABA-induced stomatal closure, resulting in increased water loss

  • Altered expression of ABA-responsive genes

  • Enhanced stability of SDIRIP1 protein

These contrasting phenotypes between overexpression and knockout lines confirm SDIR1's role as a positive regulator of ABA signaling and stress responses. Complementation experiments, where SDIR1 is reintroduced into sdir1-1 mutants, rescue the mutant phenotypes, confirming that the observed effects are specifically due to SDIR1 function .

What techniques can be used to study SDIRIP1 stability and degradation?

SDIRIP1 stability and degradation can be analyzed through several experimental approaches:

  • Protein stability assays:

    • Generate transgenic Arabidopsis plants expressing 35S:SDIRIP1-MYC in both wild-type (Col-0) and sdir1-1 backgrounds

    • Treat plants with cycloheximide (CHX) to block new protein synthesis

    • Collect samples at different time points and analyze SDIRIP1-MYC levels by western blotting

    • Compare protein degradation rates between wild-type and sdir1-1 backgrounds

  • Proteasome inhibitor treatments:

    • Treat 35S:SDIRIP1-MYC plants with the proteasome inhibitor MG132

    • Analyze SDIRIP1-MYC accumulation by western blotting

    • Compare protein levels with and without MG132 to determine the contribution of proteasomal degradation

  • Stress-induced degradation:

    • Subject plants to salt stress (NaCl treatment)

    • Monitor SDIRIP1-MYC stability in the presence of CHX

    • Compare degradation rates under normal and stress conditions

  • In vitro ubiquitination assays:

    • Reconstitute the ubiquitination reaction in vitro using purified components

    • Include E1, E2, MBP-SDIR1 (E3), GST-SDIRIP1-MYC, ubiquitin, and ATP

    • Detect ubiquitinated SDIRIP1 using anti-MYC antibodies

    • Perform control reactions omitting individual components to validate specificity

These approaches collectively provide a comprehensive understanding of how SDIR1 regulates SDIRIP1 stability through the ubiquitin-26S proteasome pathway, particularly under stress conditions.

How can researchers generate and verify SDIR1 mutants?

Generation and verification of SDIR1 mutants involve several key steps:

  • T-DNA insertion mutant identification:

    • Screen publicly available T-DNA insertion collections (e.g., SALK lines from ABRC)

    • Identify lines with insertions in the SDIR1 gene (At3g55530)

    • Request seeds from stock centers (e.g., SALK_052702/sdir1-1 and SALK_114361/sdir1-2)

  • Homozygous mutant verification:

    • Extract genomic DNA from individual plants

    • Perform diagnostic PCR using SDIR1 gene-specific primers and T-DNA border primers

    • Identify homozygous lines showing only T-DNA-specific amplification

  • Transcript analysis:

    • Extract RNA from wild-type and putative mutant plants

    • Perform RT-PCR and/or RNA gel blot analysis using SDIR1-specific probes

    • Confirm absence of SDIR1 transcripts in null alleles

  • Functional complementation:

    • Transform confirmed sdir1 mutants with 35S:SDIR1 constructs

    • Select transformants and evaluate phenotype rescue (root length, ABA sensitivity, salt response)

    • Complete rescue of mutant phenotypes confirms that the observed effects are specifically due to SDIR1 disruption

  • Phenotypic characterization:

    • Compare growth and development of wild-type and mutant plants

    • Assess responses to ABA, salt, and drought stresses

    • Document differences in primary root length, lateral root development, and aerial parts

This systematic approach ensures the generation of verified SDIR1 mutants for subsequent functional studies.

What approaches can be used to study the transcriptional regulation of SDIR1?

The transcriptional regulation of SDIR1 can be studied using multiple complementary approaches:

  • Promoter-reporter fusion analysis:

    • Clone the SDIR1 promoter region (e.g., 1.3-kb upstream of the ATG start codon)

    • Fuse with a reporter gene such as β-glucuronidase (GUS)

    • Transform into Arabidopsis and analyze spatial and temporal expression patterns

    • Subject transgenic plants to various stress treatments to monitor stress-responsive expression

  • Transcriptional profiling:

    • Perform RNA-seq or microarray analysis of plants under different stress conditions

    • Compare SDIR1 expression levels across treatments and time points

    • Identify conditions that induce or repress SDIR1 expression

  • Quantitative RT-PCR analysis:

    • Design specific primers for SDIR1

    • Extract RNA from plants subjected to various stress treatments (drought, salt, ABA, cold)

    • Perform qRT-PCR to quantify expression changes

    • Include appropriate reference genes for normalization

  • In silico promoter analysis:

    • Analyze the SDIR1 promoter sequence for known cis-regulatory elements

    • Identify potential binding sites for stress-responsive transcription factors

    • Create targeted mutations in these elements to validate their functionality

  • Chromatin immunoprecipitation (ChIP):

    • Identify candidate transcription factors that might regulate SDIR1

    • Perform ChIP assays to determine direct binding to the SDIR1 promoter

    • Quantify enrichment of promoter fragments by qPCR

These approaches provide comprehensive insights into how SDIR1 expression is regulated at the transcriptional level in response to various environmental stresses.

What are the major challenges in studying SDIR1 function?

Several challenges exist in the comprehensive study of SDIR1 function:

  • Low endogenous expression levels:

    • SDIR1 exhibits very low expression under normal growth conditions

    • Detection of native SDIR1 protein is difficult without stress induction

    • This necessitates the use of overexpression systems or sensitive detection methods

  • Protein solubility issues:

    • As a membrane-associated protein, SDIR1 may present solubility challenges during purification

    • This can complicate biochemical and structural studies

    • Fusion tags like MBP are often required to improve solubility

  • Identifying the complete set of substrates:

    • Beyond SDIRIP1, other substrates of SDIR1 may exist

    • Comprehensive identification of all targets requires advanced proteomics approaches

    • Distinguishing direct from indirect targets remains challenging

  • Redundancy in E3 ligase function:

    • The Arabidopsis genome encodes approximately 470 RING-type E3 ligases

    • Functional redundancy may mask phenotypes in single mutants

    • Creating higher-order mutants may be necessary for complete functional analysis

  • Complex stress signaling networks:

    • SDIR1 functions within complex, interconnected signaling networks

    • Dissecting specific roles from pleiotropic effects presents significant challenges

    • Temporal and spatial regulation adds additional layers of complexity

Addressing these challenges will require innovative approaches and integration of multiple experimental techniques.

What future research directions could advance our understanding of SDIR1 function?

Several promising research directions could significantly enhance our understanding of SDIR1 function:

  • Comprehensive substrate identification:

    • Employ proteomics approaches to identify the complete set of SDIR1 substrates

    • Use techniques like BioID or proximity-dependent labeling to identify proteins in close proximity to SDIR1

    • Validation of novel substrates through biochemical and genetic approaches

  • Structural studies:

    • Determine the three-dimensional structure of SDIR1 alone and in complex with SDIRIP1

    • Identify critical residues for substrate recognition and catalytic activity

    • Guide rational design of mutations for functional studies

  • Tissue-specific and inducible expression:

    • Generate tissue-specific and inducible SDIR1 expression systems

    • Dissect spatial and temporal requirements for SDIR1 function

    • Uncouple developmental from stress-responsive roles

  • Integration with other post-translational modifications:

    • Investigate potential crosstalk between ubiquitination and other modifications (phosphorylation, SUMOylation)

    • Identify regulatory modifications of SDIR1 itself that may control its activity

  • Translation to crop improvement:

    • Explore the function of SDIR1 orthologs in crop species

    • Evaluate the potential of SDIR1 manipulation for improving drought and salt tolerance

    • Develop targeted breeding or biotechnological approaches based on SDIR1 function

These research directions could significantly advance our understanding of how SDIR1-mediated ubiquitination contributes to plant stress responses and potentially lead to applications in crop improvement for enhanced stress tolerance.

What expression systems are optimal for recombinant SDIR1 production?

Several expression systems can be employed for recombinant SDIR1 production, each with specific advantages:

  • E. coli expression system:

    • Express SDIR1 as a fusion protein with solubility-enhancing tags (MBP, GST)

    • Use of BL21(DE3) or similar strains optimized for protein expression

    • Optimize induction conditions (temperature, IPTG concentration, duration)

    • Consider codon optimization for enhanced expression

    • Best suited for biochemical assays requiring large protein amounts

  • Plant-based transient expression:

    • Agrobacterium-mediated transformation of Nicotiana benthamiana leaves

    • Expression of GFP-SDIR1 fusion proteins for localization and interaction studies

    • Provides a more native cellular environment for proper folding and modifications

    • Suitable for protein-protein interaction studies (Co-IP, BiFC)

  • Stable transgenic Arabidopsis:

    • Generate 35S:SDIR1 or 35S:GFP-SDIR1 transgenic lines

    • Provides physiologically relevant expression for functional studies

    • Enables analysis of long-term phenotypic effects

    • Essential for complementation studies in sdir1 mutant backgrounds

  • Cell-free expression systems:

    • Consider wheat germ extract or rabbit reticulocyte lysate systems

    • Useful for rapid production of radiolabeled proteins for interaction studies

    • Avoids toxicity issues that may occur in cellular systems

Selection of the appropriate expression system depends on the specific experimental goals, required protein quantity, and downstream applications.

How can the E3 ligase activity of recombinant SDIR1 be preserved during purification?

Preserving the E3 ligase activity of recombinant SDIR1 during purification requires careful consideration of several factors:

  • Fusion tag selection:

    • Use solubility-enhancing tags like MBP that have been successfully employed for SDIR1

    • Confirm that the fusion does not interfere with activity by comparing with tag-cleaved protein

    • Verify functionality of fusion proteins in vivo before extensive biochemical characterization

  • Buffer optimization:

    • Include reducing agents (DTT or β-mercaptoethanol) to maintain cysteine residues in the RING domain

    • Add zinc ions (ZnCl₂) to stabilize the RING finger structure

    • Optimize pH and ionic strength based on protein stability assays

    • Consider adding glycerol (10-20%) to enhance protein stability

  • Temperature control:

    • Perform all purification steps at 4°C to minimize protein denaturation

    • Avoid freeze-thaw cycles by preparing single-use aliquots

    • Test activity immediately after purification and after storage

  • Protease inhibitors:

    • Include a comprehensive protease inhibitor cocktail during extraction and purification

    • Pay particular attention to cysteine proteases that might cleave within the RING domain

  • Activity verification:

    • Perform in vitro ubiquitination assays immediately after purification

    • Include positive controls (known active E3 ligases) and negative controls (RING domain mutants)

    • Quantify activity to assess preservation during purification and storage

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.