Recombinant Arabidopsis thaliana Ergosterol biosynthetic protein 28 (At1g10030)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Overview

At1g10030 (UniProt ID: O80594) encodes a 129-amino-acid protein homologous to yeast ERG28, functioning as a scaffolding platform for the sterol C4-demethylation (SC4DM) enzyme complex . Key attributes include:

AttributeDetail
Gene SynonymsERG28, T27I1.5, homolog of yeast ergosterol28
Protein LengthFull-length (1–129 aa)
TagN-terminal His-tag (for purification)
Expression HostE. coli or mammalian cells
Purity>90% (SDS-PAGE validated)

Biochemical Function

At1g10030 (ERG28) plays dual roles:

  • Sterol Biosynthesis: Anchors SC4DM enzymes (e.g., SMO1, CSD, SKR) in the endoplasmic reticulum, enabling sequential demethylation of sterol precursors .

  • Auxin Transport Regulation: Prevents accumulation of 4-carboxy-4-methyl-24-methylenecycloartanol (CMMC), a polar auxin transport (PAT) inhibitor. CMMC accumulation in erg28 mutants causes phenotypes such as pin-like inflorescences, leaf fusion, and reduced root growth .

Functional Complementation

  • Yeast ERG28 Rescue: Arabidopsis ERG28 restores wild-type sterol pathways in yeast erg28 mutants, confirming functional conservation .

  • SC4DM Complex Assembly: Coexpression in Nicotiana tabacum confirmed interactions with SMO1, CSD, and SKR via co-IP/affinity chromatography .

Phenotypic Effects of ERG28 Depletion

PhenotypeObservation
Shoot DevelopmentPin-like inflorescences, loss of apical dominance
Leaf MorphologyFusion of cotyledons and leaves
Root GrowthReduced elongation and sensitivity to auxin

Localization and Expression

  • ER Localization: ERG28-GFP fusion confirmed endoplasmic reticulum localization .

  • Expression Patterns: Highest in embryonic tissues, apical meristems, and roots .

Applications in Research

  • Sterol Biosynthesis Studies: Probe enzyme interactions in SC4DM complexes .

  • Auxin Transport Modulation: Investigate CMMC as a PAT inhibitor for agricultural applications .

  • Functional Complementation: Validate conserved roles across eukaryotes .

Critical Notes

  • Stability: Avoid repeated freeze-thaw cycles; use glycerol for long-term storage .

  • Ortholog Conservation: Single-copy gene in Arabidopsis, with no functional redundancy .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
At1g10030; T27I1.5; Ergosterol biosynthetic protein 28
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-129
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At1g10030
Target Protein Sequence
MKALGYWLMVVGSLRLASVWFGFFNIWALRLAVFSQTTMSEVHGRTFGVWTLLTCTLCFL CAFNLENKPLYLATFLSFIYALGHFLTEYLFYQTMTIANLSTVGFFAGTSIVWMLLEWNS LEQPHSKLS
Uniprot No.

Target Background

Gene References Into Functions
  1. ERG28 is essential for polar auxin transport in plants. PMID: 24326590
Database Links

KEGG: ath:AT1G10030

STRING: 3702.AT1G10030.1

UniGene: At.23622

Protein Families
ERG28 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Ergosterol Biosynthetic Protein 28 (At1g10030) in Arabidopsis thaliana?

Ergosterol Biosynthetic Protein 28 (At1g10030) is a transmembrane protein localized in the endoplasmic reticulum of Arabidopsis thaliana that functions in sterol biosynthesis . The protein consists of 129 amino acids and serves as a scaffold that facilitates the assembly and organization of sterol biosynthetic enzyme complexes . Based on homology studies with the yeast ortholog (Erg28p), At1g10030 acts primarily as a tethering protein that brings together various enzymes involved in sterol biosynthesis, particularly those associated with the C-4 demethylation complex . This scaffolding function is critical for the efficiency and regulation of the sterol biosynthetic pathway in plants.

How conserved is At1g10030 across different species?

At1g10030 in Arabidopsis thaliana shows significant functional conservation with its yeast counterpart, Erg28p, despite variations in primary sequence . The conservation is particularly evident in the protein's role as a scaffolding protein in sterol biosynthesis. In yeast, Erg28p has been demonstrated to interact with multiple sterol biosynthetic enzymes, including Erg27p, Erg25p, Erg11p, and Erg6p, with strong associations, and Erg26p and Erg1p with weaker interactions . This pattern of differential interaction strength suggests evolutionary conservation of not just the protein's presence but also its specific binding affinities and interaction network architecture. Researchers studying At1g10030 should consider these evolutionary relationships when designing experiments or interpreting results, particularly when translating findings between model organisms.

What expression patterns does At1g10030 exhibit in Arabidopsis thaliana?

While the search results don't provide specific expression pattern data for At1g10030, research approaches for determining its expression can be inferred from general Arabidopsis studies. Researchers typically employ microarray expression studies or RNA-seq analysis to determine tissue-specific and developmental expression patterns . Similar to the yeast ERG28 gene that was shown to be strongly coregulated with other ergosterol biosynthesis genes, At1g10030 likely exhibits coordinated expression with other sterol biosynthetic genes in Arabidopsis . The AraPheno database, which contains phenotypic data for Arabidopsis thaliana inbred lines, may provide valuable resources for correlating At1g10030 expression with phenotypic traits across different accessions .

What protein interactions has At1g10030 been shown to participate in?

Based on homology with yeast Erg28p, At1g10030 is likely involved in multiple protein-protein interactions within the sterol biosynthetic pathway. In yeast, Erg28p has been demonstrated to interact with at least seven ergosterol biosynthetic enzymes, confirmed through both yeast two-hybrid studies and coimmunoprecipitation experiments . The interactions vary in strength, with the strongest associations observed with Erg27p, Erg25p, Erg11p, and Erg6p, and weaker interactions with Erg26p and Erg1p . These interaction data suggest that At1g10030 may function similarly in Arabidopsis, potentially forming part of a large multi-enzyme complex involved in sterol biosynthesis. Researchers investigating At1g10030 should consider designing interaction studies using techniques such as co-immunoprecipitation, FRET, or split-GFP assays to verify and characterize these predicted interactions in the plant system.

How can I investigate the phenotypic effects of At1g10030 mutations in Arabidopsis?

Investigating phenotypic effects of At1g10030 mutations requires a systematic approach using available genomic and phenomic resources. The AraPheno database (https://arapheno.1001genomes.org) provides a central repository of population-scale phenotypes for Arabidopsis thaliana inbred lines, which can be particularly valuable for such studies . The database features various tools to access, download, and visualize phenotypic data, facilitating comparative analysis across different phenotypes .

To effectively investigate At1g10030 mutations:

  • Utilize existing T-DNA insertion lines or generate CRISPR/Cas9 knockout or knockdown lines

  • Perform comprehensive phenotypic characterization, including:

    • Sterol profile analysis using GC-MS

    • Growth and developmental assessments

    • Stress response evaluations

    • Cellular ultrastructure examination

The availability of full genome sequencing data for over 1000 different natural inbred lines of Arabidopsis thaliana provides a valuable resource for associating genotypic variations in At1g10030 with observable phenotypes . When interpreting results, consider that Arabidopsis plants are direct products of local adaptation, which may influence phenotypic manifestations .

What methodological approaches are most effective for studying At1g10030 protein function?

Multiple complementary methodological approaches can be employed to comprehensively study At1g10030 function:

  • Recombinant protein production: Expression of His-tagged full-length At1g10030 protein in E. coli systems provides material for biochemical and structural studies .

  • Protein interaction studies: Yeast two-hybrid systems specifically designed for membrane proteins are particularly effective for identifying interaction partners . This approach was successfully used with the yeast homolog to identify interactions with 14 sterol biosynthetic proteins .

  • Coimmunoprecipitation (co-IP): This technique serves to confirm protein-protein interactions identified through other methods and has been effectively used to validate Erg28p interactions in yeast .

  • Genetic approaches:

    • Analysis of recombinant inbred lines (RILs) can help map quantitative trait loci associated with At1g10030 variants

    • GWAS analysis using the extensive genomic data available for Arabidopsis (>1000 accessions) can reveal associations between At1g10030 polymorphisms and specific phenotypes

  • Transcriptomic analysis: Using microarrays or RNA-seq to identify genes co-regulated with At1g10030 under various conditions, similar to the approach used for yeast ERG28 .

How can I integrate At1g10030 research with large-scale genomic and phenomic datasets?

Integrating At1g10030 research with large-scale datasets requires strategic use of available resources and appropriate analytical methods:

  • Utilize AraPheno database: This central repository for Arabidopsis phenotypes allows integration of At1g10030 studies with population-scale phenotypic data . The database contained 260 phenotypes across 6 studies as of August 2016, including various trait ontology terms such as flowering time, disease resistance, and mineral concentrations .

  • Leverage recombinant inbred line (RIL) populations: These populations represent a permanent mapping resource that has been genotyped once but can be repeatedly phenotyped, making them ideal for studying quantitative traits potentially affected by At1g10030 variation .

  • Apply genome-wide association studies (GWAS): With full genome information available for over 1000 Arabidopsis accessions, GWAS can identify associations between At1g10030 variants and phenotypic differences .

  • Consider recombination dynamics: When mapping At1g10030-related traits, account for the highly variable recombination rates across Arabidopsis chromosomes, which range from as high as 251 cM/Mb to as low as 0.3 cM/Mb .

The following table summarizes key resources for integrating At1g10030 research with larger datasets:

ResourceContentApplication for At1g10030 Research
AraPheno260+ phenotypes across multiple studiesCorrelate At1g10030 variants with phenotypes
1001 GenomesFull genome data for >1000 accessionsIdentify natural variants in At1g10030
RIL populationsGenetic mapping resourcesMap At1g10030-related QTLs
ATH1 array dataTranscriptome profilesIdentify genes co-regulated with At1g10030

What expression systems are recommended for producing recombinant At1g10030 protein?

For recombinant production of At1g10030, E. coli expression systems have been successfully employed to produce full-length protein (129 amino acids) with a His-tag . This approach is particularly suitable for biochemical and structural studies. The specific considerations for optimal expression include:

  • Vector selection: Vectors containing strong inducible promoters (T7, tac) are recommended

  • Strain selection: BL21(DE3) or Rosetta strains can accommodate potential codon bias

  • Induction conditions: Optimization of IPTG concentration, temperature, and duration is critical for membrane proteins

  • Solubilization: As a transmembrane protein, proper detergent selection for solubilization is essential

  • Purification strategy: Nickel affinity chromatography followed by size exclusion chromatography

For studies requiring native folding and post-translational modifications, alternative expression systems such as yeast (P. pastoris) or insect cells (Sf9) may be more appropriate, though these would need to be optimized specifically for At1g10030.

How can I design experiments to investigate At1g10030's role in sterol biosynthesis?

To effectively investigate At1g10030's role in sterol biosynthesis, a multi-faceted experimental approach is recommended:

  • Genetic manipulation:

    • Generate knockout/knockdown lines using T-DNA insertion or CRISPR/Cas9

    • Create overexpression lines using constitutive or inducible promoters

    • Develop complementation lines with mutated versions to identify critical domains

  • Biochemical analysis:

    • Perform sterol profiling using GC-MS or LC-MS to identify changes in sterol composition

    • Measure activities of sterol biosynthetic enzymes in mutant vs. wild-type backgrounds

    • Conduct in vitro reconstitution assays with purified proteins to study complex formation

  • Cellular localization:

    • Use fluorescent protein fusions to confirm ER localization

    • Employ co-localization studies with known sterol biosynthetic enzymes

    • Perform subcellular fractionation followed by western blotting

  • Interaction studies:

    • Apply membrane-specific yeast two-hybrid systems similar to those used for yeast Erg28p

    • Conduct coimmunoprecipitation experiments to validate interactions in planta

    • Use proximity labeling approaches (BioID, APEX) to identify the interaction network

  • Phenotypic characterization:

    • Assess growth and development under normal and stress conditions

    • Examine membrane integrity and fluidity in mutant plants

    • Analyze responses to sterol biosynthesis inhibitors

These approaches, when combined, can provide comprehensive insights into At1g10030's function in sterol biosynthesis and its broader physiological roles.

What strategies can be used to study At1g10030 interactions with other sterol biosynthetic enzymes?

Based on research with the yeast homolog Erg28p, several strategies can be effectively employed to study At1g10030 interactions with other sterol biosynthetic enzymes:

  • Modified yeast two-hybrid (Y2H) systems: Standard Y2H systems are often ineffective for membrane proteins. Instead, use specialized split-ubiquitin Y2H systems designed specifically for membrane protein interactions . This approach was successfully used with Erg28p as bait to assess interactions with 14 sterol biosynthetic proteins .

  • Coimmunoprecipitation (co-IP): This technique provides in vivo validation of protein-protein interactions. For At1g10030, design experiments with epitope-tagged versions of the protein expressed in Arabidopsis, followed by immunoprecipitation and detection of interacting partners . In yeast studies, this approach confirmed seven interactions identified through Y2H screening .

  • Bimolecular fluorescence complementation (BiFC): This approach allows visualization of protein interactions in living plant cells and can confirm the subcellular localization of these interactions.

  • Proximity-dependent biotin identification (BioID): This technique can identify proteins in close proximity to At1g10030 in the native cellular environment, potentially revealing both direct and indirect interaction partners.

  • Quantitative interaction assessment: By comparing reporter gene expression levels in Y2H or fluorescence intensity in FRET/BiFC, it's possible to determine relative interaction strengths, similar to how Erg28p was found to associate more strongly with Erg27p, Erg25p, Erg11p, and Erg6p than with Erg26p and Erg1p .

  • Protein complex isolation: Blue native PAGE or size exclusion chromatography coupled with mass spectrometry can help determine if At1g10030 participates in a large sterol biosynthetic complex, as suggested for yeast Erg28p .

How should I analyze gene expression data related to At1g10030?

When analyzing gene expression data for At1g10030, consider the following methodological approaches:

  • Utilize appropriate normalization methods: When working with microarray or RNA-seq data, proper normalization is essential to account for technical variability. For Arabidopsis studies, techniques such as those used with Affymetrix GeneChips for analyzing the unfolded protein response can serve as a methodological guide .

  • Consider co-expression networks: Since the yeast ERG28 is strongly coregulated with other ergosterol biosynthesis genes , analyze At1g10030 expression in the context of other sterol biosynthetic genes to identify co-regulation patterns. Tools like ATTED-II or CoExpNetViz are particularly useful for this purpose.

  • Integrate multiple data types: Combine transcriptomic data with proteomics, metabolomics, and phenomics data available through resources like AraPheno to build a comprehensive understanding of At1g10030 function.

  • Account for natural variation: When analyzing expression across different Arabidopsis accessions, consider the extensive natural genetic variation and its impact on expression patterns. The availability of full genome sequences for over 1000 accessions provides context for interpreting expression differences .

  • Apply appropriate statistical methodologies: Use methods that account for the specific experimental design, such as linear mixed models for studies involving multiple accessions or conditions, and appropriate multiple testing corrections for genome-wide analyses.

What are the key considerations when interpreting phenotypic data from At1g10030 mutant studies?

When interpreting phenotypic data from At1g10030 mutant studies, researchers should consider several critical factors:

  • Genetic background effects: Variations in the genetic background can significantly influence phenotypic manifestations. In Arabidopsis, different accessions may show distinct phenotypic responses to the same mutation due to the extensive natural genetic variation present in the species .

  • Functional redundancy: Consider possible redundancy with other genes that might compensate for At1g10030 loss, potentially masking phenotypic effects. This is particularly relevant when studying members of protein families.

  • Environmental interactions: Phenotypes related to sterol metabolism may be differentially expressed under various environmental conditions. Plants are products of local adaptation , so phenotyping under multiple conditions is essential.

  • Developmental timing: Sterol requirements can vary throughout plant development, so temporal aspects of phenotypic analysis are crucial. Comprehensive phenotyping should include multiple developmental stages.

  • Quantitative trait analysis: Many sterol-related phenotypes are likely to be quantitative rather than qualitative. The recombinant inbred line (RIL) resources available for Arabidopsis allow for mapping of quantitative trait loci (QTLs) that may interact with or modify At1g10030-related phenotypes .

  • Membrane-related phenotypes: As sterols are critical membrane components, detailed analyses of membrane properties, fluidity, and composition should be considered when interpreting broader physiological phenotypes.

How can comparative analysis between yeast Erg28p and Arabidopsis At1g10030 inform research approaches?

Comparative analysis between yeast Erg28p and Arabidopsis At1g10030 offers valuable insights that can inform research approaches:

  • Functional conservation assessment: The established scaffold function of yeast Erg28p in tethering the C-4 demethylation complex and interacting with multiple sterol biosynthetic enzymes provides a framework for investigating At1g10030's role . Researchers should design experiments to test whether At1g10030 performs similar scaffolding functions in Arabidopsis.

  • Interaction partner prediction: The yeast Erg28p interactions with seven ergosterol biosynthetic enzymes (particularly strong associations with Erg27p, Erg25p, Erg11p, and Erg6p) suggest potential interaction partners for At1g10030 in Arabidopsis. This knowledge can guide targeted interaction studies rather than unbiased screening approaches.

  • Structural insights: Though detailed structural information is limited in the provided search results, any structural data available for yeast Erg28p could inform hypotheses about At1g10030's functional domains and mechanisms.

  • Metabolic pathway integration: The role of Erg28p in the yeast ergosterol biosynthetic pathway provides context for investigating At1g10030's position in the plant sterol biosynthetic pathway, which differs in some aspects from the fungal pathway.

  • Evolutionary adaptation understanding: Comparing the functions of these homologous proteins across different kingdoms can reveal evolutionary adaptations in sterol biosynthesis, potentially informing both basic science questions and applications in metabolic engineering.

What are the emerging techniques that could advance At1g10030 research?

Emerging techniques that could significantly advance At1g10030 research include:

  • CRISPR/Cas9 genome editing: Beyond simple knockouts, CRISPR technologies now allow precise editing, base changes, and conditional mutations that could help create an allelic series of At1g10030 variants to dissect its function .

  • Single-cell transcriptomics: This approach could reveal cell-type-specific expression patterns of At1g10030 and co-regulated genes, providing insights into its tissue-specific functions.

  • Cryo-electron microscopy: This technique could potentially resolve the structure of At1g10030 within the sterol biosynthetic complex, elucidating its scaffolding mechanism.

  • Proximity labeling techniques: Methods like TurboID or APEX2 could map the At1g10030 protein interaction network in living plant cells with temporal and spatial resolution.

  • Computational biology approaches: Advanced modeling using the wealth of genomic data available for Arabidopsis can help predict the impact of natural variation in At1g10030 on plant phenotypes across diverse environments .

  • High-resolution genetic mapping: Techniques that allowed the generation of a 676-marker genetic linkage map in Arabidopsis could help precisely map QTLs related to At1g10030 function and identify genetic modifiers.

What are the most promising applications of At1g10030 research in plant biotechnology?

While the search results don't directly address biotechnological applications of At1g10030, several promising directions can be inferred:

  • Metabolic engineering of sterols: Understanding At1g10030's role in organizing sterol biosynthetic enzymes could facilitate engineering of sterol metabolism for enhanced stress tolerance or modified sterol profiles.

  • Protein scaffolding technology: The natural scaffolding properties of At1g10030 could potentially be adapted to create synthetic scaffolds for metabolic engineering of other pathways, improving flux through desired routes.

  • Membrane engineering: Insights into how At1g10030 affects membrane sterol composition could inform strategies for modifying membrane properties to enhance crop resistance to temperature extremes or drought.

  • Agrochemical development: Understanding the sterol biosynthetic complex architecture could guide the development of more selective antifungal agents that target fungal-specific aspects of the pathway without affecting plant homologs.

  • Stress tolerance improvement: Given the role of sterols in membrane integrity and signaling, manipulating At1g10030 function could potentially enhance plant tolerance to various stresses, contributing to climate resilience in crops.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.