Recombinant Arabidopsis thaliana Ethylene receptor 1 (ETR1)

Shipped with Ice Packs
In Stock

Description

Overview of ETR1

ETR1 is a receptor for ethylene, a plant hormone involved in numerous developmental and physiological processes . ETR1 is unique among Arabidopsis ethylene receptors because it possesses both histidine kinase activity and a receiver domain . Although ETR1's histidine kinase activity isn't essential for ethylene signaling, it modulates signal output through an unknown mechanism .

Function and Mechanism

In the absence of ethylene, the receptors, including ETR1, positively regulate CONSTITUTIVE TRIPLE RESPONSE1 (CTR1), which acts as a negative regulator of the pathway . CTR1 inhibits downstream components, preventing ethylene responses . When ethylene binds to the receptors, their activity reduces, leading to decreased CTR1 kinase activity and reduced phosphorylation of EIN2 protein . This reduction in EIN2 phosphorylation causes a rise in EIN2 protein levels and proteolytic separation, ultimately affecting EIN3 and EIL1 transcription factors and leading to ethylene responses .

Unique Role of ETR1

ETR1 has a distinct role in modulating the effects of red and far-red light on plant development, particularly seed germination . Studies indicate that ETR1 inhibits germination after far-red light treatment and in the dark, affecting responses to red and far-red light, unlike the other four ethylene receptor isoforms .

Interaction with RTE1

REVERSION-TO-ETHYLENE SENSITIVITY1 (RTE1) is a membrane protein that promotes the signaling state of ETR1 through the ETR1 N-terminal domain . RTE1 and ETR1 co-localize to the endoplasmic reticulum (ER) and Golgi apparatus in Arabidopsis . Research has demonstrated a physical association between RTE1 and ETR1, confirmed through in vivo and in vitro methods, suggesting RTE1 regulates ETR1 ethylene signaling .

ETR1 and Nutations

Ethylene stimulates nutations (oscillatory movements) in Arabidopsis seedlings . Studies with etr1-7 loss-of-function mutants showed that ethylene-stimulated nutations were eliminated, and introducing a wild-type genomic ETR1 transgene rescued the nutation phenotype, confirming ETR1's requirement for this process .

ETR1's Predominant Role

Research indicates that ETR1 alone is sufficient for certain ethylene responses, such as the effects of silver on seedling growth . In triple mutants lacking ETR1, ETR2, and EIN4, ethylene responses were not blocked by silver, but transformation with cETR1 completely restored responses to silver .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
ETR1; At1g66340; T27F4.9; Ethylene receptor 1; AtETR1; Protein ETHYLENE RESPONSE 1; Protein ETR1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-738
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ETR1
Target Protein Sequence
MEVCNCIEPQWPADELLMKYQYISDFFIAIAYFSIPLELIYFVKKSAVFPYRWVLVQFGA FIVLCGATHLINLWTFTTHSRTVALVMTTAKVLTAVVSCATALMLVHIIPDLLSVKTREL FLKNKAAELDREMGLIRTQEETGRHVRMLTHEIRSTLDRHTILKTTLVELGRTLALEECA LWMPTRTGLELQLSYTLRHQHPVEYTVPIQLPVINQVFGTSRAVKISPNSPVARLRPVSG KYMLGEVVAVRVPLLHLSNFQINDWPELSTKRYALMVLMLPSDSARQWHVHELELVEVVA DQVAVALSHAAILEESMRARDLLMEQNVALDLARREAETAIRARNDFLAVMNHEMRTPMH AIIALSSLLQETELTPEQRLMVETILKSSNLLATLMNDVLDLSRLEDGSLQLELGTFNLH TLFREVLNLIKPIAVVKKLPITLNLAPDLPEFVVGDEKRLMQIILNIVGNAVKFSKQGSI SVTALVTKSDTRAADFFVVPTGSHFYLRVKVKDSGAGINPQDIPKIFTKFAQTQSLATRS SGGSGLGLAISKRFVNLMEGNIWIESDGLGKGCTAIFDVKLGISERSNESKQSGIPKVPA IPRHSNFTGLKVLVMDENGVSRMVTKGLLVHLGCEVTTVSSNEECLRVVSHEHKVVFMDV CMPGVENYQIALRIHEKFTKQRHQRPLLVALSGNTDKSTKEKCMSFGLDGVLLKPVSLDN IRDVLSDLLEPRVLYEGM
Uniprot No.

Target Background

Function
Ethylene receptor related to bacterial two-component regulators. Functions as a redundant negative regulator of ethylene signaling. In the presence of ethylene, ETR1's auto-kinase activity is inhibited, and the unphosphorylated kinase domain binds tightly to the corresponding domain of EIN2.
Gene References Into Functions

ETR1 Function: Research Findings Summary

  1. The ETR1 receiver domain functions actively upon formation, interacting with downstream factors without phosphorylation. PMID: 27486797
  2. The ETR1 receiver domain exhibits multiple functions, with distinct surfaces controlling different traits. PMID: 26160962
  3. The cytosolic domain of ETR1 plays a key role, interacting with other receptors and components of the ethylene signaling pathway. PMID: 25451923
  4. Bacillus sp. B55, associated with Nicotiana attenuata roots, promotes growth of wild-type and, especially, ethylene-insensitive (35)S-etr1 plants expressing mutant Arabidopsis thaliana ETR1-1. PMID: 23903320
  5. ETR1's histidine kinase activity is not essential but modulates ethylene responses. PMID: 22467798
  6. Organelle abnormalities were linked to a secondary mutation in ARC3, not etr1-1 or ethylene signaling, as confirmed by genetic complementation. PMID: 22228186
  7. An ETR1 kinase domain mutation (H353A) preventing auto-phosphorylation increases receptor affinity for EIN2. PMID: 20591837
  8. Impaired ethylene perception via ETR1 enhances resistance to Verticillium dahliae. PMID: 20447269
  9. Induced etr1-1 expression represses epinastic responses to ethylene and delays fruit ripening, with ethylene sensitivity restored upon cessation of induction. PMID: 20181754
  10. Cyanide inhibition of ETR1 autophosphorylation in Arabidopsis thaliana is regulated by ethylene or ethylene agonists. PMID: 19825547
  11. Histidine kinase activity is unnecessary for ethylene receptor function in plants; signal transduction doesn't occur through a phosphorelay mechanism. PMID: 15358768
  12. The His kinase domain in the C-terminal region of Arabidopsis ETR1 plays a role in repressing ethylene responses. PMID: 15466228
  13. Five Arabidopsis thaliana receptor isoforms confirmed high-affinity ethylene-binding activity in all family members. PMID: 15703053
  14. ETR1 mediates stomatal closure in response to H2O2. PMID: 15761208
  15. RTE1 is a negative regulator of ethylene signaling and plays a significant role in ETR1 function. PMID: 16682642
  16. Subfamily I receptors and disulfide linkages in the ETR1 N-terminus mediate signal output. PMID: 16891553
  17. The ETR1 receptor is necessary for ethylene-stimulated nutations. PMID: 17071649
  18. The ethylene-binding domain (EBD) is a negative regulator of the signal transmitter domain. PMID: 17189345
  19. The role of ETR1's histidine kinase activity in A. thaliana growth and development is reported. PMID: 17284582
  20. RTE1 positively regulates ETR1 via the EBD, independently of RAN1 activity. PMID: 18643990
Database Links

KEGG: ath:AT1G66340

STRING: 3702.AT1G66340.1

UniGene: At.43238

Protein Families
Ethylene receptor family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Leaves, roots, stems, seedlings, flowers, anthers, carpels and ovules.

Q&A

What is the basic structure and organization of ETR1?

ETR1 is a membrane-bound receptor belonging to the two-component histidine protein kinase family, which is primarily found in prokaryotes. The protein consists of several functional domains, with the N-terminal domain (amino acids 1-349) being particularly important for ethylene binding and signaling. The N-terminal portion contains the ethylene-binding domain, while the C-terminal region is involved in signal transduction .

The receptor is embedded in cellular membranes, predominantly in the endoplasmic reticulum (ER) and Golgi apparatus, where it functions as a negative regulator of ethylene responses in the absence of ethylene binding . The unique structural features of ETR1 distinguish it from other ethylene receptors in Arabidopsis, particularly in terms of its interaction with regulatory proteins such as RTE1 (REVERSION-TO-ETHYLENE SENSITIVITY) .

How does ETR1 function in ethylene signaling?

ETR1 functions as a negative regulator of ethylene responses. In the absence of ethylene, ETR1 actively suppresses ethylene response pathways through constitutive signaling . When ethylene binds to the receptor, this signaling is inhibited, thereby activating downstream ethylene responses in the plant .

This mechanism represents a "default on" signaling system, where the receptor's natural state is to repress ethylene responses, and ethylene binding switches this repression off. The signaling state of ETR1 is further modulated by its interaction with other proteins, most notably RTE1, which promotes ETR1's active signaling state through its N-terminal domain . Downstream of ETR1, the CTR1 Raf-like kinase functions as another negative regulator of ethylene responses, forming part of the signaling cascade initiated by the receptor .

How is ETR1 different from other ethylene receptors in Arabidopsis?

ETR1 displays distinct characteristics that set it apart from other ethylene receptors in Arabidopsis, such as ERS1. A particularly notable distinction is the ETR1-specific response to certain mutations. Genetic analyses have revealed that dominant mutations in the ethylene-binding domain of ETR1 that confer ethylene insensitivity fail to produce the same effect when introduced at identical positions in the ERS1 gene, despite the high sequence conservation between these receptors .

This specificity appears to be related to the dependence of ETR1 on RTE1 for its function. Unlike other ethylene receptors, ETR1 requires RTE1 to maintain its active signaling state, and mutations in RTE1 can suppress certain dominant ethylene-insensitive mutations in ETR1 . This suggests fundamental differences in how ETR1 and other ethylene receptors function, possibly due to distinct conformational characteristics or regulatory mechanisms.

What cellular compartments contain ETR1 protein?

ETR1 localizes predominantly to the endoplasmic reticulum (ER) and Golgi apparatus in Arabidopsis cells . This subcellular localization has been demonstrated through various methods, including the co-localization of ETR1 with known ER and Golgi markers.

The membrane association of ETR1 is crucial for its function, as it allows the receptor to bind ethylene, which is a hydrophobic hormone that can diffuse through membranes. The co-localization of ETR1 with RTE1 in these compartments further supports the functional interaction between these proteins and suggests that the regulation of ETR1 by RTE1 occurs primarily at these subcellular locations .

What are the primary methods for producing recombinant ETR1?

Producing recombinant ETR1 for research purposes typically involves expression systems that can accommodate membrane proteins. Several approaches have been successfully employed:

  • Bacterial expression systems: Using E. coli strains optimized for membrane protein expression, often with modifications to the ETR1 sequence to improve solubility and expression levels.

  • Tryptophan-less versions: For studies utilizing tryptophan fluorescence spectroscopy, researchers have developed tryptophan-less versions of ETR1 that maintain functionality while allowing for specific fluorescence measurements .

  • Truncated constructs: The N-terminal domain (amino acids 1-349) has been expressed separately for studies focusing on ethylene binding and interactions with regulatory proteins like RTE1 .

When purifying recombinant ETR1, it's essential to maintain the protein in detergent micelles or reconstituted membranes to preserve its native conformation and functionality. Affinity tags such as His-tags are commonly used to facilitate purification, with subsequent size-exclusion chromatography to ensure homogeneity of the preparation .

How can protein-protein interactions with ETR1 be studied in vivo?

Protein-protein interactions involving ETR1 can be studied using several complementary approaches:

  • Bimolecular Fluorescence Complementation (BiFC): This technique has been successfully employed to demonstrate the interaction between ETR1 and RTE1 in living plant cells. The method involves fusing fragments of a fluorescent protein to potential interaction partners, which reconstitute a functional fluorophore when brought together by protein-protein interaction .

  • Co-immunoprecipitation (Co-IP): This biochemical approach has confirmed the physical association between ETR1 and RTE1 in Arabidopsis. It involves using antibodies to precipitate ETR1 from plant extracts and then detecting co-precipitated proteins by immunoblotting .

  • Transgenic expression systems: Both transient expression in tobacco cells and stable transformation in Arabidopsis have been used to study ETR1 interactions in planta .

These methods provide complementary information about the spatial and temporal dynamics of ETR1 interactions with its partners in the cellular context where they naturally occur.

What techniques are used to measure ETR1 binding affinity to other proteins?

Quantitative measurement of binding affinities between ETR1 and interacting proteins requires specialized biophysical techniques:

  • Tryptophan fluorescence spectroscopy: This method has been used to determine the dissociation constant (Kd) between ETR1 and RTE1. By using a tryptophan-less version of ETR1 and monitoring changes in intrinsic tryptophan fluorescence upon binding, researchers measured a high-affinity interaction with a Kd of 117 nM .

  • Surface Plasmon Resonance (SPR): While not explicitly mentioned in the search results, this technique is commonly used for measuring protein-protein interactions and could be applied to study ETR1 binding kinetics.

  • Isothermal Titration Calorimetry (ITC): This method provides both binding constants and thermodynamic parameters of interactions and would be suitable for studying ETR1 interactions with partners like RTE1.

The choice of method depends on the specific question being addressed, the availability of purified proteins, and the expected affinity range of the interaction. For high-affinity interactions like ETR1-RTE1, tryptophan fluorescence spectroscopy has proven effective when proper controls are implemented .

How can researchers verify the subcellular localization of ETR1?

Determining the subcellular localization of ETR1 typically employs imaging techniques combined with specific markers:

  • Fluorescent protein fusions: By creating fusion proteins with GFP or other fluorescent tags, researchers can visualize ETR1 distribution in living cells.

  • Co-localization studies: Using markers for specific organelles (ER, Golgi) in combination with labeled ETR1 allows researchers to determine where ETR1 resides. Studies have shown that ETR1 co-localizes with ER and Golgi markers in Arabidopsis cells .

  • Cellular fractionation: Biochemical separation of cellular components followed by immunoblotting can confirm the presence of ETR1 in specific membrane fractions.

  • Immunogold electron microscopy: For highest resolution determination of subcellular localization, immunogold labeling combined with electron microscopy can precisely pinpoint the membrane systems where ETR1 resides.

When designing localization experiments, it's important to consider whether the fluorescent tag might affect the localization or function of ETR1, and to include appropriate controls to validate the observed patterns.

What experimental evidence demonstrates ETR1-RTE1 interaction?

Multiple complementary approaches have established the physical interaction between ETR1 and RTE1:

  • Bimolecular Fluorescence Complementation (BiFC): This technique demonstrated the in vivo interaction between ETR1 and RTE1 in both tobacco cells (transient expression) and stably transformed Arabidopsis. The reconstitution of fluorescence indicates that these proteins come into close proximity in living cells .

  • Co-immunoprecipitation: ETR1 and RTE1 were shown to co-precipitate from Arabidopsis extracts, providing biochemical evidence for their association in plant tissues .

  • Tryptophan fluorescence spectroscopy: Using purified recombinant proteins, this biophysical technique established that ETR1 and RTE1 interact with high affinity (Kd of 117 nM), indicating a specific and stable interaction .

  • Genetic evidence: The dependence of certain ETR1 functions on RTE1, and the ability of RTE1 mutations to suppress specific ETR1 dominant mutations, provide additional support for a functional interaction between these proteins .

Together, these multiple lines of evidence, spanning in vivo, biochemical, biophysical, and genetic approaches, provide strong support for a direct and functionally significant interaction between ETR1 and RTE1.

How does the RTE1 C161Y mutation affect its interaction with ETR1?

The RTE1 C161Y mutation significantly impairs the interaction between RTE1 and ETR1. Tryptophan fluorescence spectroscopy revealed that this amino acid substitution causes a nearly 12-fold increase in the dissociation constant (from 117 nM for wild-type RTE1 to 1.38 μM for the C161Y mutant) . This indicates a substantial reduction in binding affinity between the mutant RTE1 and ETR1.

This biochemical effect correlates with the genetic observation that the C161Y mutation in RTE1 confers an ETR1 loss-of-function phenotype . The weakened interaction likely prevents RTE1 from properly promoting the signaling state of ETR1, resulting in altered ethylene responses in plants.

The specific location of this mutation suggests that the cysteine at position 161 in RTE1 is critical for maintaining the proper conformation needed for high-affinity binding to ETR1. This provides a molecular explanation for the genetic effects observed with this mutation and highlights the importance of specific residues in mediating protein-protein interactions in signaling pathways.

What is the functional significance of the ETR1-RTE1 interaction?

The ETR1-RTE1 interaction plays a crucial role in regulating ethylene signaling:

  • Promotion of ETR1 signaling: Genetic analyses suggest that RTE1 promotes the active signaling state of ETR1, which represses ethylene responses . This influence appears to be specific to ETR1 among the ethylene receptors.

  • Regulation through the N-terminal domain: RTE1 exerts its effect on ETR1 through the receptor's N-terminal domain (residues 1-349), which includes the ethylene-binding region . This suggests RTE1 may influence how ETR1 responds to ethylene binding.

  • Specificity in ethylene insensitivity: Certain dominant mutations in ETR1 that confer ethylene insensitivity are dependent on RTE1 function, while similar mutations introduced into other ethylene receptors like ERS1 do not have the same effect . This indicates that the ETR1-RTE1 interaction contributes to the unique properties of ETR1-mediated ethylene insensitivity.

  • Evolutionary conservation: RTE1 is conserved in plants and metazoans , suggesting that its regulatory function may extend beyond plants and represent a fundamental mechanism for controlling receptor signaling.

The high-affinity interaction between these proteins (Kd of 117 nM) and the dramatic effect of the C161Y mutation on both binding affinity and phenotype underscore the physiological importance of this protein-protein interaction in regulating ethylene perception and response.

What domains of ETR1 are involved in the interaction with RTE1?

The N-terminal portion of ETR1 appears to be primarily responsible for interaction with RTE1. Specifically:

  • BiFC experiments with a truncated version of ETR1 comprising only the N terminus (amino acids 1-349) demonstrated that this region is sufficient for association with RTE1 .

  • Genetic evidence supports this interaction domain, as RTE1 promotes the signaling state of ETR1 through the N-terminal domain of the receptor .

  • The N-terminal domain of ETR1 includes the ethylene-binding region, suggesting that RTE1 may influence how ETR1 responds to ethylene by affecting the conformation or activity of this domain .

This localization of the interaction to the N-terminal portion of ETR1 is consistent with the functional role of RTE1 in modulating ethylene perception and signaling. It suggests that RTE1 may affect how the ETR1 N-terminal domain responds to ethylene binding or transmits this information to the signaling domain of the receptor.

How do dominant ETR1 mutations confer ethylene insensitivity?

Dominant mutations in ETR1 typically confer ethylene insensitivity through one of two mechanisms:

  • Preventing ethylene binding: Many dominant mutations occur in the ethylene-binding domain and prevent the hormone from binding to the receptor. Without ethylene binding, the receptor remains in its active signaling state, continuously repressing ethylene responses regardless of ethylene concentration .

  • Locking the receptor in active conformation: Some mutations may not directly affect ethylene binding but instead lock the receptor in a conformation that signals constitutively, even when ethylene is bound. These mutations prevent the conformational changes normally induced by ethylene binding .

The resulting phenotype is ethylene insensitivity, where plants fail to display normal responses to ethylene, such as the triple response in seedlings (inhibition of hypocotyl and root elongation, exaggeration of apical hook curvature) or accelerated senescence in adult plants. This occurs because the mutant ETR1 continuously represses ethylene responses, even in the presence of the hormone .

Why do some ETR1 mutations fail to confer ethylene insensitivity when introduced in other ethylene receptors?

Some dominant ETR1 mutations that confer ethylene insensitivity fail to produce the same effect when introduced at identical positions in other ethylene receptors like ERS1, despite high sequence conservation. This receptor-specific effect appears to be related to RTE1 dependence:

  • RTE1 dependence: The ETR1-specific dominant mutations are suppressed by mutations in RTE1, indicating that these mutations require RTE1 function to confer ethylene insensitivity .

  • Conformational differences: These mutations likely lead to an altered conformation of the ETR1 ethylene-binding domain that enables constitutive signaling. When introduced in ERS1 or other receptors, they may not result in the same conformational change, possibly due to subtle structural differences between receptors .

  • Lack of RTE1 action: Other ethylene receptors may lack the ability to interact with RTE1 or to be modified by RTE1 in the same way as ETR1, preventing these mutations from having the same effect .

This distinction highlights fundamental differences between ETR1 and other ethylene receptors in Arabidopsis, suggesting unique structural features or regulatory mechanisms specific to ETR1 signaling.

How can researchers design experiments to study ETR1-specific mutations?

To effectively study ETR1-specific mutations, researchers should consider the following experimental approaches:

  • Comparative mutagenesis: Introduce identical mutations in multiple ethylene receptors (ETR1, ERS1, etc.) and compare their effects on ethylene sensitivity through phenotypic assays. This approach can identify truly ETR1-specific effects .

  • Receptor chimeras: Create chimeric receptors combining domains from ETR1 and other receptors (e.g., ERS1) to determine which regions of ETR1 are responsible for the unique effects of certain mutations. This approach could identify domains responsible for RTE1 dependence .

  • Suppressor screens: Screen for genetic suppressors of dominant ETR1 mutations to identify additional components that influence ETR1-specific signaling. RTE1 was identified through such approaches .

  • Structural analysis: Use purified recombinant receptors (wild-type and mutant) for structural studies (X-ray crystallography, cryo-EM) to directly visualize how ETR1-specific mutations affect receptor conformation compared to other receptors.

  • Interaction assays: Compare protein-protein interactions of wild-type and mutant receptors to identify differences in interaction partners or binding affinities that might explain ETR1-specific effects.

These complementary approaches can provide mechanistic insights into the unique properties of ETR1 among ethylene receptors and how specific mutations exert their effects.

What methods are used to evaluate ethylene sensitivity in ETR1 mutants?

Evaluating ethylene sensitivity in ETR1 mutants typically employs several standardized assays:

  • Triple response assay: This classic assay measures the response of dark-grown seedlings to ethylene, which normally includes inhibition of hypocotyl and root elongation, exaggeration of apical hook curvature, and radial swelling of the hypocotyl. Ethylene-insensitive mutants show reduced responses compared to wild-type plants .

  • Dose-response experiments: By exposing plants to varying concentrations of ethylene and measuring growth parameters, researchers can quantify the degree of ethylene sensitivity or insensitivity in different mutants.

  • Adult plant phenotyping: Analyses of leaf senescence, flower senescence, and fruit ripening (all ethylene-regulated processes) in mature plants can reveal ethylene sensitivity defects not apparent in seedlings.

  • Molecular marker analysis: Measuring the expression of ethylene-responsive genes (e.g., by RT-PCR, RNA-seq, or reporter gene constructs) provides a molecular readout of ethylene sensitivity independent of morphological changes.

  • Combination with other mutations: Analyzing double mutants combining etr1 mutations with mutations in other components of the ethylene signaling pathway can provide insights into the specificity and mechanism of ETR1 function.

These methods allow researchers to characterize the nature and extent of ethylene insensitivity conferred by various ETR1 mutations, facilitating the comparison of different alleles and their effects on plant development and physiology.

How does ETR1 interact with downstream components like CTR1?

ETR1 physically associates with CTR1, a Raf-like kinase that acts as a negative regulator of ethylene responses . This interaction represents a key step in the ethylene signaling pathway:

  • Physical association: ETR1 and CTR1 physically interact, with CTR1 being recruited to the ER membrane where ETR1 is located .

  • Functional significance: This association is thought to activate CTR1, which then represses downstream ethylene responses. When ethylene binds to ETR1, the receptor's conformation changes, likely altering its interaction with CTR1 and inactivating CTR1's repressive function .

  • Specificity questions: While the search results don't explicitly address whether all ethylene receptors interact equally with CTR1, the ETR1-CTR1 association appears to be a crucial aspect of ethylene signal transduction.

  • Experimental approaches: Co-immunoprecipitation, yeast two-hybrid assays, and in vivo protein-protein interaction techniques like BiFC have been used to study this interaction, though specific experimental details are not provided in the search results.

Understanding the molecular details of how ethylene binding to ETR1 affects its interaction with CTR1 remains an important area of research for elucidating the mechanism of ethylene signal transduction.

What approaches can be used to study ETR1 structural changes upon ethylene binding?

Investigating ETR1 structural changes upon ethylene binding presents significant challenges due to the membrane-associated nature of the receptor, but several approaches can be employed:

  • Biophysical techniques:

    • X-ray crystallography of the soluble domains or full-length protein in detergent micelles

    • Cryo-electron microscopy to visualize the receptor with and without ethylene

    • Hydrogen-deuterium exchange mass spectrometry to identify regions with altered solvent accessibility upon ethylene binding

  • Spectroscopic methods:

    • Tryptophan fluorescence spectroscopy, which has been successfully used to study ETR1-RTE1 interactions , could also monitor conformational changes upon ethylene binding

    • Circular dichroism to detect secondary structure changes

    • FTIR spectroscopy to examine conformational transitions

  • Molecular probes:

    • Site-directed spin labeling combined with electron paramagnetic resonance (EPR) spectroscopy

    • Introduction of fluorescent labels at specific positions to monitor distance changes using FRET

  • Computational approaches:

    • Molecular dynamics simulations of the receptor with and without bound ethylene

    • Homology modeling based on related receptors with known structures

  • Functional assays:

    • Mutational analysis targeting specific residues hypothesized to be involved in conformational changes

    • Accessibility of specific residues to chemical modification before and after ethylene binding

These complementary approaches can provide insights into how ethylene binding alters ETR1 conformation and how these changes affect interactions with partners like RTE1 and CTR1.

How can researchers resolve contradictory data regarding ETR1 function?

Resolving contradictory data regarding ETR1 function requires systematic approaches:

  • Experimental design considerations:

    • Use the Controlled Trial Method, which provides a structured approach for testing hypotheses through controlled experiments

    • Ensure proper randomization, control, and measurement in experimental design

    • Consider whether differences in experimental systems (e.g., transient expression vs. stable transformation) might explain contradictory results

  • Genetic approach:

    • Create and analyze higher-order mutants to address potential functional redundancy among ethylene receptors

    • Use receptor chimeras to pinpoint domains responsible for specific functions or contradictory observations

    • Employ CRISPR/Cas9 technology for precise gene editing to avoid potential artifacts from traditional mutagenesis

  • Biochemical validation:

    • Confirm protein expression levels in different experimental systems

    • Verify subcellular localization of wild-type and mutant proteins

    • Assess protein-protein interactions using multiple complementary techniques

  • Meta-analysis:

    • Systematically compare methodologies used in contradictory studies

    • Analyze experimental variables (plant growth conditions, developmental stages, tissue types) that might explain differences

    • Consider genetic background effects that could influence experimental outcomes

  • Collaborative approach:

    • Establish standardized protocols across research groups

    • Perform interlaboratory validation studies for controversial findings

    • Share reagents and materials to minimize technical variation

By systematically addressing these aspects, researchers can identify the sources of contradictory data and develop a more consistent understanding of ETR1 function.

What are the current challenges in understanding ETR1 signaling mechanisms?

Several challenges remain in fully understanding ETR1 signaling mechanisms:

  • Structural challenges:

    • Obtaining high-resolution structures of full-length ETR1, particularly in complex with ethylene

    • Determining how ethylene binding induces conformational changes that affect signaling

    • Understanding the structural basis for ETR1's unique properties compared to other ethylene receptors

  • Mechanistic questions:

    • Precisely how RTE1 modifies ETR1 function at the molecular level

    • The mechanism by which ethylene binding to ETR1 affects its interaction with and regulation of CTR1

    • How ETR1 histidine kinase activity (if any) relates to its signaling function

  • Physiological complexity:

    • Determining the relative contributions of different ethylene receptors in various tissues and developmental stages

    • Understanding how environmental factors modulate ETR1 function

    • Elucidating cross-talk between ETR1 and other hormone signaling pathways

  • Technical limitations:

    • Difficulties in working with membrane proteins in biochemical and structural studies

    • Challenges in visualizing protein-protein interactions in native membrane environments

    • Limited temporal resolution in measuring rapid signaling events

  • Translational aspects:

    • Applying knowledge of Arabidopsis ETR1 to understand ethylene perception in crops

    • Developing tools to modulate ethylene sensitivity in specific tissues or developmental stages

Addressing these challenges will require interdisciplinary approaches combining genetics, biochemistry, structural biology, and systems biology to develop a comprehensive understanding of ETR1 signaling.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.