Recombinant Arabidopsis thaliana Ethylene receptor 2 (ETR2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your preference in the order notes. We will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please let us know and we will prioritize developing the specified tag.
Synonyms
ETR2; At3g23150; K14B15.9; Ethylene receptor 2; AtETR2; Protein ETHYLENE RESPONSE 2; Protein ETR2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-773
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ETR2
Target Protein Sequence
MVKEIASWLLILSMVVFVSPVLAINGGGYPRCNCEDEGNSFWSTENILETQRVSDFLIAV AYFSIPIELLYFVSCSNVPFKWVLFEFIAFIVLCGMTHLLHGWTYSAHPFRLMMAFTVFK MLTALVSCATAITLITLIPLLLKVKVREFMLKKKAHELGREVGLILIKKETGFHVRMLTQ EIRKSLDRHTILYTTLVELSKTLGLQNCAVWMPNDGGTEMDLTHELRGRGGYGGCSVSME DLDVVRIRESDEVNVLSVDSSIARASGGGGDVSEIGAVAAIRMPMLRVSDFNGELSYAIL VCVLPGGTPRDWTYQEIEIVKVVADQVTVALDHAAVLEESQLMREKLAEQNRALQMAKRD ALRASQARNAFQKTMSEGMRRPMHSILGLLSMIQDEKLSDEQKMIVDTMVKTGNVMSNLV GDSMDVPDGRFGTEMKPFSLHRTIHEAACMARCLCLCNGIRFLVDAEKSLPDNVVGDERR VFQVILHIVGSLVKPRKRQEGSSLMFKVLKERGSLDRSDHRWAAWRSPASSADGDVYIRF EMNVENDDSSSQSFASVSSRDQEVGDVRFSGGYGLGQDLSFGVCKKVVQLIHGNISVVPG SDGSPETMSLLLRFRRRPSISVHGSSESPAPDHHAHPHSNSLLRGLQVLLVDTNDSNRAV TRKLLEKLGCDVTAVSSGFDCLTAIAPGSSSPSTSFQVVVLDLQMAEMDGYEVAMRIRSR SWPLIVATTVSLDEEMWDKCAQIGINGVVRKPVVLRAMESELRRVLLQADQLL
Uniprot No.

Target Background

Function
Ethylene receptor related to bacterial two-component regulators. Functions as a redundant negative regulator of ethylene signaling.
Gene References Into Functions
  1. ETR1 and ETR2 play both ethylene-dependent and -independent roles in plant cells, influencing responses to abscissic acid. PMID: 29158332
  2. ETR2 is degraded through a proteasome-dependent pathway in response to ethylene binding. PMID: 17595158
  3. ETR2 regulates trichome branching by controlling microtubule assembly. PMID: 19648171
Database Links

KEGG: ath:AT3G23150

STRING: 3702.AT3G23150.1

UniGene: At.43502

Protein Families
Ethylene receptor family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in seedlings, roots, leaves, flowers, mature siliques, shoot apical meristems, leaf primordia, inflorescence meristems, young floral meristems, developing petals, carpels and ovules. Low expression in stamens.

Q&A

What is the structure and function of ETR2 in Arabidopsis thaliana?

ETR2 is a membrane protein that exhibits sequence homology to the ethylene receptor gene ETR1 and the ETR1-like ERS gene, suggesting it may encode a third ethylene receptor in Arabidopsis thaliana . Structurally, ETR2 contains transmembrane domains responsible for ethylene binding, a GAF domain, and a kinase domain, closely resembling the "two-component" structure seen in other ethylene receptors . The ETR2 protein functions as a negative regulator of ethylene responses, where in its active state (without ethylene binding), it suppresses downstream ethylene signaling pathways .

The expression pattern of ETR2 is ubiquitous but shows higher expression in specific tissues including inflorescence and floral meristems, petals, and ovules, suggesting tissue-specific regulatory roles . Functionally, ETR2 regulates various aspects of plant growth and development, including etiolated seedling elongation, leaf expansion, and leaf senescence . When ethylene binds to the transmembrane domains of ETR2, it likely results in the inactivation of the receptor activity, leading to a "transmitter-off" state that permits ethylene responses to occur .

To study ETR2's function in a laboratory setting, researchers can implement gene expression analysis using RT-PCR, which has revealed that ETR2 is a weakly expressed gene with higher expression levels in flowers and leaves . Additionally, protein localization studies can help determine where ETR2 functions within the cell, providing further insight into its role in ethylene signal transduction.

How does ETR2 differ from other ethylene receptors in Arabidopsis?

Arabidopsis thaliana contains five ethylene receptors (ETR1, ERS1, ETR2, EIN4, and ERS2) that are structurally similar to prokaryotic two-component modules . While ETR2 shares sequence homology with ETR1 and ERS, it possesses distinct characteristics that differentiate it from other family members . One key difference is in the kinase domain activity - unlike ETR1 which functions as a histidine kinase, ETR2 with its diverged His kinase domain operates as a Ser/Thr kinase and can phosphorylate its receiver domain .

The expression patterns also differ among ethylene receptors. ETR2 is ubiquitously expressed but shows higher expression in specific tissues including inflorescence and floral meristems, petals, and ovules . This differentiated expression pattern suggests specialized functions in different developmental contexts. Additionally, an interesting characteristic of ETR2 is that cDNA containing the second intron was detected in reverse transcription PCR analysis, with about 14% of the total amplified cDNA in flowers and leaves being of the unspliced class, potentially leading to a shorter protein product .

For experimental approaches to differentiate between ethylene receptors, researchers often use receptor-specific antibodies for western blotting, gene-specific probes for in situ hybridization, or create receptor-specific mutations through CRISPR/Cas9 or T-DNA insertion. Genetic complementation experiments, where individual receptor genes are expressed in receptor mutant backgrounds, can reveal the specific functions of each receptor type.

What genetic techniques are used to study ETR2 function in Arabidopsis?

Multiple genetic approaches have been employed to characterize ETR2 function in Arabidopsis. Initially, ethylene-insensitive mutants were isolated through the "triple response" assay, where etiolated seedlings exhibiting long hypocotyls and roots in the presence of ethylene were selected . The dominant etr2-1 mutant was identified from an ethyl methanesulfonate (EMS)-mutagenized population of 100,000 M2 seedlings using this seedling growth response screen .

For mapping ETR2, researchers employed Restriction Fragment Length Polymorphism (RFLP) and Simple Sequence Length Polymorphism (SSLP) methods using 60-70 F3 families homozygous for ethylene-insensitive phenotypes . The gene was ultimately cloned based on its map position, revealing its sequence homology to ETR1 and ERS genes . To identify specific mutations in etr2-1, researchers amplified the ETR2 coding region from wild-type and mutant plant tissues by PCR, followed by sequencing to identify the precise genetic alteration .

Transgenic approaches have also been instrumental in studying ETR2 function. Full-length ETR2 genomic fragments from both wild-type and etr2-1 mutant plants were introduced into Arabidopsis through Agrobacterium-mediated transformation using the in planta vacuum infiltration method . These transgenic plants allowed researchers to confirm the dominant nature of the etr2-1 mutation and characterize its effects on ethylene sensitivity. RNA interference (RNAi) and T-DNA insertion mutations have been used to create ETR2 loss-of-function plants, which exhibit phenotypes such as enhanced ethylene sensitivity and early flowering, providing complementary information to the gain-of-function studies .

How does ETR2 signaling integrate with the broader ethylene response pathway?

ETR2 occupies a specific position within the ethylene signaling cascade, acting upstream of CTR1 (a Raf-related protein kinase) as demonstrated through double mutant analysis . This positioning is similar to ETR1 and EIN4, which also act upstream of CTR1 in the ethylene signaling pathway . The genetic pathway for ethylene signal transduction has been deduced through double mutant analyses, revealing that ETR2, like other ethylene receptors, functions at the beginning of the signal transduction chain .

Mechanistically, ethylene binding to the transmembrane domains of ETR2 likely results in the inactivation of receptor activity, leading to a "transmitter-off" state . This inactivation allows the ethylene response to proceed through the downstream components of the pathway. ETR2's function appears to be primarily dependent on its interaction with other pathway components, as its overexpression or mutation can significantly alter ethylene sensitivity .

To experimentally assess ETR2's integration with the ethylene pathway, researchers often conduct dose-response analyses of hypocotyl elongation in dark-grown seedlings. Such analyses have shown that etr2-1 mutation primarily affects the degree of maximal responsiveness to ethylene rather than altering the threshold or saturation concentrations . This characteristic is similar to what has been observed for the reduced-sensitivity etr1-2 mutant, suggesting parallel mechanisms of action .

Protein-protein interaction studies using techniques such as yeast two-hybrid assays, co-immunoprecipitation, or bimolecular fluorescence complementation can reveal direct interactions between ETR2 and other components of the ethylene signaling pathway. These approaches help determine how ETR2 physically connects with its upstream regulators and downstream targets to mediate ethylene responses.

What mechanisms regulate ETR2 expression and protein abundance?

Interestingly, post-transcriptional regulation may also play a role in controlling ETR2 protein production. RT-PCR analysis has detected cDNA containing the second intron, with approximately 14% of the total amplified cDNA in flowers and leaves being of the unspliced class . This retention of the second intron could potentially lead to a shorter protein product, suggesting that alternative splicing might be a mechanism to generate ETR2 protein variants with potentially different functions .

At the protein level, ETR2's abundance and activity may be regulated through its localization within cellular compartments. While detailed information about ETR2's subcellular localization is not provided in the search results, other ethylene receptors like ETR1 have been found to be associated with the endoplasmic reticulum (ER) . This localization pattern suggests that ETR2 might also be regulated through its association with specific membrane compartments.

Experimental approaches to study ETR2 regulation include promoter-reporter gene fusions to analyze transcriptional regulation, protein tagging with epitopes or fluorescent proteins to track protein abundance and localization, and pulse-chase experiments to determine protein stability. Additionally, chromatin immunoprecipitation (ChIP) can identify transcription factors that bind to the ETR2 promoter, while RNA immunoprecipitation (RIP) can identify RNA-binding proteins that might regulate ETR2 mRNA processing or stability.

How does the ETR2 kinase domain function in signal transduction?

The ETR2 receptor possesses a kinase domain that diverges from the classical histidine kinase domains found in other ethylene receptors. Unlike ETR1, which functions as a histidine kinase, ETR2 operates as a Ser/Thr kinase and can phosphorylate its receiver domain . This biochemical activity is crucial for ETR2's role in signal transduction, as it allows for the transfer of phosphoryl groups to specific amino acid residues in target proteins.

Experimental evidence has shown that mutation of the N box of the kinase domain abolishes the kinase activity of ETR2, highlighting the essential nature of this domain for ETR2 function . The N box is likely involved in nucleotide binding, which is necessary for the kinase to transfer phosphate groups. The receiver domain of ETR2 serves as a substrate for its own kinase activity, suggesting that intramolecular phosphorylation may regulate ETR2 function .

The transition from histidine kinase activity in some ethylene receptors to serine/threonine kinase activity in ETR2 represents an interesting evolutionary adaptation that may confer specific signaling properties. This diversification in kinase activity among ethylene receptors could contribute to the complexity and fine-tuning of ethylene responses in plants.

To investigate the kinase activity of ETR2 experimentally, researchers might employ in vitro kinase assays using purified recombinant ETR2 protein and potential substrates. Site-directed mutagenesis of key residues in the kinase domain can help identify amino acids essential for catalytic activity. Additionally, phosphoproteomic approaches can be used to identify phosphorylation targets of ETR2 in vivo, providing insights into its downstream signaling mechanisms.

What structural features determine ETR2's specificity in ethylene binding and signal transduction?

The dominant etr2-1 mutation confers ethylene insensitivity, suggesting that this genetic alteration prevents ethylene binding or disrupts the conformational changes normally induced by ethylene binding . Identifying the precise location and nature of this mutation would provide valuable insights into the structural features critical for ETR2 function. Comparative analysis with other ethylene receptor mutations that confer insensitivity could reveal common structural principles of ethylene perception.

Beyond the transmembrane domains, the GAF domain of ETR2 may play a role in protein-protein interactions or in regulating the conformation of the receptor . The kinase domain with its diverged His kinase activity functions as a Ser/Thr kinase that can phosphorylate the receiver domain . This unique kinase activity suggests that ETR2 may phosphorylate different substrates compared to other ethylene receptors, potentially activating distinct downstream signaling pathways.

Experimental approaches to investigate ETR2's structural features include X-ray crystallography or cryo-electron microscopy to determine the three-dimensional structure of the protein, hydrogen-deuterium exchange mass spectrometry to identify regions that undergo conformational changes upon ethylene binding, and molecular dynamics simulations to predict how specific mutations affect protein structure and function. Site-directed mutagenesis of conserved and non-conserved residues followed by functional assays can identify amino acids critical for ETR2's specific functions.

How do post-translational modifications regulate ETR2 activity?

Post-translational modifications (PTMs) likely play crucial roles in regulating ETR2 activity, although specific information about ETR2 PTMs is limited in the provided search results. As a Ser/Thr kinase, ETR2 can phosphorylate its receiver domain, suggesting that autophosphorylation may be an important regulatory mechanism . This intramolecular phosphorylation could induce conformational changes that alter ETR2's activity or its interaction with other proteins in the signaling pathway.

Beyond autophosphorylation, ETR2 might be subject to other types of PTMs that regulate its activity, stability, or localization. These could include phosphorylation by other kinases, ubiquitination which might target ETR2 for degradation, SUMOylation which could affect protein-protein interactions, or glycosylation which might influence protein folding or stability. The balance of these modifications would determine the pool of active ETR2 receptors available for ethylene sensing.

The association of ETR2 with specific cellular compartments might also be regulated by PTMs. If ETR2 follows the pattern of ETR1, it might be associated with the endoplasmic reticulum (ER) . PTMs could potentially regulate the trafficking of ETR2 to different membrane compartments, affecting its accessibility to ethylene or to downstream signaling components.

To experimentally investigate PTMs of ETR2, researchers could employ mass spectrometry-based proteomics to identify modification sites, generate antibodies that recognize specific PTMs to track modified ETR2 in different conditions, or create non-modifiable mutants through site-directed mutagenesis to assess the functional importance of specific modifications. Additionally, identifying the enzymes responsible for adding or removing these modifications would provide further insights into the regulatory mechanisms controlling ETR2 activity.

What developmental and environmental factors influence ETR2-mediated ethylene responses?

ETR2-mediated ethylene responses are influenced by a complex interplay of developmental and environmental factors. During development, ETR2 plays roles in multiple processes including etiolated seedling elongation, leaf expansion, and leaf senescence . The expression pattern of ETR2, with higher levels in certain tissues such as inflorescence and floral meristems, petals, and ovules, suggests tissue-specific regulation and function .

Flowering time appears to be significantly influenced by ETR2 activity. Overexpression of ETR2 in transgenic rice plants reduces ethylene sensitivity and delays floral transition, while RNA interference (RNAi) plants and the etr2 T-DNA insertion mutant exhibit early flowering and enhanced ethylene sensitivity . Additionally, ETR2 affects reproductive development, as evidenced by reduced effective panicles and seed-setting rate in ETR2-overexpressing plants, contrasted with substantially enhanced thousand-seed weight in certain contexts .

Environmental stresses likely modulate ETR2-mediated ethylene responses, as ethylene is known to mediate stress responses such as wound response and pathogen response . The "triple response" of etiolated seedlings to ethylene (short and thick hypocotyl, short root, and exaggerated apical hook) represents an adaptation to growth in soil, and ETR2 plays a role in regulating this response . How specific environmental factors like light, temperature, drought, or pathogen infection alter ETR2 expression or activity remains an important area for investigation.

Experimental approaches to study the influence of developmental and environmental factors on ETR2-mediated responses include time-course analyses of ETR2 expression and ethylene sensitivity throughout development, comparing wild-type and etr2 mutant responses to various stresses, and investigating the effects of hormonal crosstalk by applying multiple hormones and analyzing their combined effects on ETR2 expression and function. Additionally, chromatin immunoprecipitation sequencing (ChIP-seq) of transcription factors that respond to developmental or environmental cues could reveal whether they directly regulate ETR2 expression.

What are the molecular mechanisms underlying the differential effects of ETR2 mutations versus overexpression?

The molecular mechanisms underlying the differential effects of ETR2 mutations versus overexpression represent an intriguing aspect of ethylene receptor function. The dominant etr2-1 mutation confers ethylene insensitivity in several processes, including etiolated seedling elongation, leaf expansion, and leaf senescence . This insensitivity likely results from the mutant receptor's inability to bind ethylene or to undergo the conformational changes normally induced by ethylene binding, causing it to remain constitutively active and continuously suppress ethylene responses.

In contrast, overexpression of wild-type ETR2 in transgenic plants also reduces ethylene sensitivity but may do so through a different mechanism . By increasing the abundance of wild-type receptors, overexpression might create a higher threshold of ethylene required to inactivate all receptors, thereby dampening ethylene responses. This effect would depend on the total receptor pool and could be influenced by the relative abundance of other ethylene receptors.

Loss-of-function approaches through RNA interference (RNAi) or T-DNA insertion produce opposite phenotypes to the dominant mutation or overexpression, exhibiting enhanced ethylene sensitivity and early flowering . This enhanced sensitivity likely results from a reduced pool of active receptors that normally suppress ethylene responses, allowing the signaling pathway to be activated more readily by lower concentrations of ethylene.

To experimentally distinguish between these mechanisms, researchers could perform quantitative analyses of ethylene binding in different genetic backgrounds, measure the phosphorylation status of downstream targets in response to ethylene in mutant versus overexpression lines, or use protein-protein interaction assays to determine how mutations or overexpression affect ETR2's association with other signaling components. Additionally, creating transgenic lines with varying levels of wild-type or mutant ETR2 expression could establish dose-response relationships between receptor abundance and ethylene sensitivity.

What are the optimal protocols for expressing and purifying recombinant ETR2 protein?

Expressing and purifying recombinant ETR2 protein presents significant challenges due to its membrane-associated nature and multiple domains. Researchers aiming to work with ETR2 protein must carefully consider expression systems, solubilization methods, and purification strategies to obtain functional protein for biochemical and structural studies.

For expression systems, bacterial hosts like Escherichia coli offer simplicity and high yield but may struggle with proper folding of plant membrane proteins. Eukaryotic systems such as yeast (Saccharomyces cerevisiae or Pichia pastoris), insect cells (using baculovirus expression), or plant-based expression systems might provide better folding environments for ETR2. Each system requires optimization of expression constructs, potentially including fusion tags (His, GST, MBP) to aid in purification and solubility, and codon optimization for the host organism.

Membrane protein solubilization presents a critical step in ETR2 purification. Detergents such as n-dodecyl-β-D-maltoside (DDM), digitonin, or lauryl maltose neopentyl glycol (LMNG) can be tested for their ability to extract ETR2 from membranes while maintaining protein stability and function. Alternatively, nanodiscs or styrene-maleic acid lipid particles (SMALPs) can provide a more native-like membrane environment for solubilized ETR2.

Purification strategies typically involve affinity chromatography using tagged ETR2 constructs, followed by size exclusion chromatography to remove aggregates and obtain homogeneous protein. For functional studies, it's essential to verify that purified ETR2 retains its ethylene-binding capacity and kinase activity. Ethylene-binding assays using radiolabeled ethylene or ethylene analogs, and in vitro kinase assays with ATP and potential substrates, can confirm the functionality of purified ETR2.

How can the kinase activity of ETR2 be accurately measured in vitro and in vivo?

Measuring the kinase activity of ETR2 accurately requires complementary in vitro and in vivo approaches that capture different aspects of its enzymatic function. Since ETR2 functions as a Ser/Thr kinase rather than a His kinase, methods optimized for detecting phosphorylated serine and threonine residues are most appropriate .

For in vitro kinase assays, purified recombinant ETR2 protein (full-length or kinase domain) is typically incubated with ATP (often [γ-32P]ATP for radioactive detection or ATP analogs for non-radioactive methods) and potential substrate proteins. The receiver domain of ETR2 itself serves as a substrate, as ETR2 can phosphorylate this domain . Reaction products are analyzed by SDS-PAGE followed by autoradiography, phosphor imaging, or western blotting with phospho-specific antibodies. Kinetic parameters (Km, Vmax) can be determined by varying substrate or ATP concentrations, while the effects of potential inhibitors or activators can be assessed by including these compounds in the reaction.

Mutation studies provide valuable insights into ETR2 kinase function. The finding that mutation of the N box abolishes ETR2 kinase activity highlights the importance of this domain for catalytic function . Creating additional mutations in conserved kinase motifs and testing their effects on activity can further elucidate the structural basis of ETR2's kinase mechanism.

For in vivo measurements, researchers can use phospho-specific antibodies against ETR2 or its substrates to detect phosphorylation events in plant extracts. Alternatively, mass spectrometry-based phosphoproteomics can identify phosphorylation sites on ETR2 and potential substrates, comparing phosphorylation patterns between wild-type plants and etr2 mutants or ETR2-overexpressing lines. Additional approaches include in situ kinase assays where plant tissue sections are incubated with ATP analogs that can be specifically labeled, or the use of genetically encoded FRET-based biosensors that report on kinase activity in living cells.

What experimental designs are most effective for studying ETR2 protein-protein interactions?

Studying ETR2 protein-protein interactions requires robust experimental designs that can detect both stable and transient interactions in the context of membrane-associated proteins. Multiple complementary approaches are necessary to build a comprehensive understanding of ETR2's interaction network.

Yeast two-hybrid (Y2H) systems, particularly modified versions designed for membrane proteins such as the split-ubiquitin Y2H, can identify potential interaction partners for ETR2. This approach involves fusing ETR2 (or specific domains) to one half of ubiquitin and potential interactors to the other half, with interaction reconstituting ubiquitin and triggering a reporter gene. While Y2H can generate candidate interactions, these should be validated through additional methods due to potential false positives.

Co-immunoprecipitation (Co-IP) represents a gold standard for confirming protein-protein interactions in plant tissues. This approach involves using antibodies against ETR2 (or an epitope tag on recombinant ETR2) to pull down the receptor and its associated proteins from plant extracts, followed by mass spectrometry or western blotting to identify co-precipitated proteins. Crosslinking agents can help capture transient interactions before extraction.

For visualizing interactions in living cells, bimolecular fluorescence complementation (BiFC) offers a powerful approach. ETR2 and a potential interactor are fused to complementary fragments of a fluorescent protein (e.g., YFP), with interaction bringing the fragments together to reconstitute fluorescence. Förster resonance energy transfer (FRET) between fluorescently tagged proteins provides another live-cell interaction detection method, with the advantage of potentially measuring interaction dynamics.

In vitro methods such as surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) can provide quantitative binding parameters (affinity constants, binding stoichiometry) for ETR2 interactions. These approaches require purified proteins and can be challenging for membrane proteins but offer valuable biophysical insights when successful.

How can researchers effectively generate and validate transgenic plants with modified ETR2 expression?

Generating and validating transgenic plants with modified ETR2 expression requires careful experimental design and thorough validation to ensure reliable phenotypic analysis. Several approaches have been successfully employed in ETR2 research, providing a framework for effective transgenic strategies.

For overexpression studies, full-length ETR2 genomic fragments can be cloned into plant transformation vectors under the control of constitutive promoters like CaMV 35S or tissue-specific promoters for targeted expression . The in planta vacuum infiltration method using Agrobacterium tumefaciens has been successfully used for introducing ETR2 constructs into Arabidopsis . Selection of transformants typically relies on antibiotic resistance markers (kanamycin resistance has been used at 50 mg/liter for ETR2 transformants) to identify plants carrying the transgene .

For reducing ETR2 expression, RNA interference (RNAi) constructs targeting ETR2-specific sequences have proven effective . Alternatively, T-DNA insertion mutants in ETR2 provide valuable loss-of-function resources . The CRISPR/Cas9 system offers a newer approach for generating precise mutations or deletions in the ETR2 gene, although this wasn't mentioned in the search results for ETR2 research.

Validation of transgenic lines is critical and should include multiple levels of analysis. Molecular validation through PCR verification of transgene presence, RT-PCR or qRT-PCR measurement of ETR2 transcript levels, and western blotting for protein expression provides the foundation for confirming the intended genetic modification . Phenotypic validation through the triple response assay for etiolated seedlings offers a straightforward method to assess ethylene sensitivity . Dose-response analysis of hypocotyl elongation in the presence of varying ethylene concentrations provides a quantitative measure of ethylene sensitivity changes in transgenic lines .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.