Recombinant Arabidopsis thaliana Ethylene response sensor 1 (ERS1)

Shipped with Ice Packs
In Stock

Description

Overview of ERS1

ERS1 is a protein that functions as an ethylene receptor in Arabidopsis thaliana . Genetic studies indicate that, in the absence of ethylene, the receptors positively regulate CONSTITUTIVE TRIPLE RESPONSE1 (CTR1), which inhibits downstream components to prevent ethylene responses .

Biochemical Characterization of ERS1

ERS1, similar to ETR1, forms a membrane-associated, disulfide-linked dimer when expressed in yeast . Yeast expressing ERS1 contains ethylene-binding sites, showing ERS1 is an ethylene-binding protein, which supports genetic evidence that ETR1 isoforms also function as ethylene receptors in plants .

Functional Studies of ERS1

  • Negative Regulation: ERS1 inhibits the ethylene signaling pathway, implying negative receptor collaboration .

  • Dual Functions: ERS1 represses ethylene responses and promotes them in an ETR1-dependent manner .

ERS1 and Ethylene Response

Ethylene binding to receptors reduces receptor activity, which leads to reduced activity of the CTR1 kinase, resulting in reduced phosphorylation of EIN2 protein . This reduction in EIN2 phosphorylation leads to a decrease in ubiquitination of EIN2, causing a rise in EIN2 protein levels and proteolytic separation of the C-terminal portion of the protein from the N-terminal portion . The C-terminal region of EIN2 increases the levels of the EIN3 and EIL1 transcription factors, leading to most ethylene responses .

ERS1 Interaction with Other Receptors

Wild-type receptor genes differentially supported the repression of ethylene responses by ers1-1 . ETR1 and ETHYLENE INSENSITIVE4 (EIN4) supported ers1-1 .

ERS1 and Light Treatment

Of the five ethylene receptor isoforms in Arabidopsis, ETR1 has a unique role in modulating the effects of red and far-red light on plant development . ETR1 inhibits germination after far-red light treatment and in the dark .

ERS1 and Stress Response

ETR1 affects ABA signaling or synthesis, and also affects ABA, GA, and perhaps ethylene in stress responses .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ERS1; ERS; At2g40940; T20B5.14; Ethylene response sensor 1; AtERS1; Protein ERS1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-613
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ERS1
Target Protein Sequence
MESCDCFETHVNQDDLLVKYQYISDALIALAYFSIPLELIYFVQKSAFFPYKWVLMQFGA FIILCGATHFINLWMFFMHSKAVAIVMTIAKVSCAVVSCATALMLVHIIPDLLSVKNREL FLKKKADELDREMGLILTQEETGRHVRMLTHGIRRTLDRHTILRTTLVELGKTLCLEECA LWMPSQSGLYLQLSHTLSHKIQVGSSVPINLPIINELFNSAQAMHIPHSCPLAKIGPPVG RYSPPEVVSVRVPLLHLSNFQGSDWSDLSGKGYAIMVLILPTDGARKWRDHELELVENVA DQVAVALSHAAILEESMHARDQLMEQNFALDKARQEAEMAVHARNDFLAVMNHEMRTPMH AIISLSSLLLETELSPEQRVMIETILKSSNLVATLISDVLDLSRLEDGSLLLENEPFSLQ AIFEEVISLIKPIASVKKLSTNLILSADLPTYAIGDEKRLMQTILNIMGNAVKFTKEGYI SIIASIMKPESLQELPSPEFFPVLSDSHFYLCVQVKDTGCGIHTQDIPLLFTKFVQPRTG TQRNHSGGGLGLALCKRFVGLMGGYMWIESEGLEKGCTASFIIRLGICNGPSSSSGSMAL HLAAKSQTRPWNW
Uniprot No.

Target Background

Function
Ethylene receptor involved in bacterial two-component regulatory systems. Functions as a redundant negative regulator of ethylene signaling.
Gene References Into Functions
  1. ERS1 regulates the expression of a subset of ethylene-responsive genes, influencing the magnitude of the ethylene response. PMID: 25988998
  2. ERS1's repression of ethylene responses is primarily mediated through ETR1 and EIN4. PMID: 22227969
  3. ERS1 exhibits dual regulatory functions in ethylene responses. PMID: 20374664
  4. Analysis of the etr1 ers1 double knockout mutant in Arabidopsis thaliana revealed novel, previously uncharacterized receptor functions. PMID: 17224067
  5. AtTRP1 interacts with ERS1, influencing cross-talk between ethylene and auxin signaling. PMID: 19567478
Database Links

KEGG: ath:AT2G40940

STRING: 3702.AT2G40940.1

UniGene: At.21783

Protein Families
Ethylene receptor family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in etiolated seedlings, leaves, stems, roots, flowers, embryos, anthers, carpels and ovules.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.