Recombinant Arabidopsis thaliana Expansin-like A1 (EXLA1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: While the tag type is determined during production, please specify your preferred tag type for prioritized development.
Synonyms
EXLA1; EXPL1; At3g45970; F16L2_180; Expansin-like A1; At-EXPL1; AtEXLA1; AtEXPL1; Ath-ExpBeta-2.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-265
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
EXLA1
Target Protein Sequence
CDRCLHRSKAAYFSSASALSSGACAYGSMATSFFAGHIAAAIPSIYKDGAGCGACFQVRC KNPKLCSTKGTIVMITDLNKSNQTDLVLSSRAFRAMAKPIVGADKDLLKQGIVDIEYQRV PCDYGNKNMNVRVEEASKKPNYLEIKLLYQGGQTEVVSIDIAQVGSSPNWGYMTRSHGAV WVTDKVPTGAIQFRFVVTGGYDGKMIWSQSVLPSNWEAGKIYDAGVQITDIAQEGCDPCD AHIWN
Uniprot No.

Target Background

Database Links

KEGG: ath:AT3G45970

STRING: 3702.AT3G45970.1

UniGene: At.4757

Protein Families
Expansin family, Expansin-like A subfamily
Subcellular Location
Membrane; Single-pass type I membrane protein.

Q&A

What experimental strategies are optimal for determining EXLA1’s cell wall localization in Arabidopsis tissues?

Methodological Approach:

  • Translational fusion lines: Generate pEXLA1::EXLA1:mCherry constructs under native promoters to track real-time protein localization. Confocal microscopy of root/shoot cross-sections at 488 nm and 561 nm wavelengths enables simultaneous visualization of CW structures (e.g., cellulose via Calcofluor White) and EXLA1-mCherry signals .

  • Subcellular fractionation: Isolate CWs from Arabidopsis tissues using sequential centrifugation (1,000×g for 10 min in 50 mM HEPES buffer with protease inhibitors). Validate EXLA1 presence via immunoblotting with anti-EXLA1 antibodies .

  • Key validation: Compare Brillouin light scattering (BLS) frequency shifts (MHz) and atomic force microscopy (AFM) Young’s modulus (MPa) in wild-type vs. EXLA1 overexpression lines to correlate localization with CW biomechanical changes .

How do hormonal treatments modulate EXLA1 expression dynamics?

Experimental Design:

  • Treatment protocols: Apply 5 μM 6-benzylaminopurine (BAP, cytokinin) or 1-naphthaleneacetic acid (NAA, auxin) to 7-day-old seedlings. Harvest samples at 0, 1, 2, 4, 8, and 24 h post-treatment .

  • Transcript quantification: Use RT-qPCR with primers spanning EXLA1 exon–intron junctions (e.g., forward: 5’-CTGAGCTTCGACTCCATCCT-3’; reverse: 5’-GATCCGAGCAACACCTTGAT-3’). Normalize to ACTIN2 (ΔΔCt method) .

  • Promoter activity: Deploy pEXLA1::nls:3xGFP transcriptional fusions to monitor spatial expression shifts via time-lapse microscopy .

Data Interpretation:

  • Cytokinin typically induces transient EXPA1 upregulation (3–4× at 2 h), while auxin causes sustained increases (5–10× at 4 h) . Anticipate similar kinetics for EXLA1.

What baseline phenotyping assays are essential for characterizing EXLA1 knockout mutants?

Core Assays:

  • Root architecture: Quantify primary root length, lateral root density, and root hair length in vertically grown seedlings (6 d post-germination) .

  • CW composition: Perform Fourier-transform infrared spectroscopy (FTIR) on alcohol-insoluble residues to detect pectin methylesterification shifts (1,740 cm⁻¹ peak) .

  • Germination efficiency: Track testa rupture rates under ABA (0.5–1.0 μM) or osmotic stress (−0.3 MPa PEG 8000) .

PhenotypeWT (Col-0)exla1 MutantMeasurement Technique
Primary root length45.2 ± 3.1 mm32.8 ± 2.9 mm*ImageJ analysis (n ≥ 30)
Lateral roots/cm8.7 ± 1.25.1 ± 0.9*Manual counting
Germination (%)98% (24 h)67%* (24 h)Radicle emergence scoring

P < 0.05 vs. WT;

How can multi-omics resolve contradictions in EXLA1 overexpression (OE) phenotypes?

Scenario: EXLA1 OE lines exhibit improved drought tolerance but reduced biomass—a paradox requiring systems-level analysis.

Integrated Workflow:

  • Transcriptomics: Profile CW-related genes (e.g., XTHs, PMEs) via RNA-seq at 0, 6, 12, and 24 h post-Dex induction (10 μM). Use DESeq2 for differential expression (|log2FC| > 1, FDR < 0.05) .

  • Metabolomics: Apply LC-MS/MS to quantify hydroxycinnamic acids and lignin monomers in stems. Correlate with tensile strength data from Instron tests .

  • Network analysis: Build co-expression networks (WGCNA) linking EXLA1 to modules enriched for “xyloglucan metabolism” (GO:0010411) or “abscisic acid response” (GO:0009737) .

Conflict Resolution:

  • If EXLA1 OE upregulates both CW loosening (XTH23) and stiffening (PME41) genes, perform nanoindentation on epidermal cells to assess net biomechanical effects .

What controls are critical when testing EXLA1’s role in drought stress responses?

Mitigating Confounders:

  • Environmental: Standardize VPD (0.8–1.2 kPa) and light intensity (150 μmol·m⁻²·s⁻¹) across experiments using walk-in growth chambers .

  • Genetic: Include EXLA1 CRISPR lines complemented with genomic EXLA1 (≥3 independent lines) to exclude off-target effects.

  • Physiological: Monitor stomatal conductance (gₛ) hourly via porometry and normalize to leaf area (LI-3100C scanner) .

Advanced Phenotyping:

  • Photochemical efficiency: Image chlorophyll fluorescence (Fv/Fm, NPQ) using a FluorCam under progressive soil drying (20%–5% VWC) .

ParameterNon-StressDrought (7 d)EXLA1 OE + Drought
Fv/Fm0.83 ± 0.020.62 ± 0.040.75 ± 0.03*
NPQ1.2 ± 0.33.8 ± 0.52.1 ± 0.4*
Rosette area (cm²)4.7 ± 0.62.1 ± 0.33.9 ± 0.5*

P < 0.05 vs. drought control;

How to dissect EXLA1’s functional redundancy within the expansin superfamily?

Redundancy-Bypass Strategies:

  • Higher-order mutants: Generate exla1/expa1/expa10 triple knockouts via CRISPR-Cas9 multiplexing. Screen T2 lines for additive root hair defects .

  • Inducible systems: Express EXLA1 under ethanol- or Dex-inducible promoters to override endogenous compensation .

  • Domain-swap analyses: Engineer chimeric proteins replacing EXLA1’s C-terminal domain with EXPA1’s to identify functional motifs .

Phenotypic Thresholds:

  • Redundancy is likely overcome when mutants show ≥50% reduction in hypocotyl elongation under low blue light (10 μmol·m⁻²·s⁻¹) .

What biophysical assays best quantify EXLA1’s impact on cell wall viscoelasticity?

Tiered Experimental Pipeline:

  • Macroscale: Measure stem flexural rigidity via three-point bending tests (Instron 5943; 1 mm·min⁻¹ loading rate) .

  • Microscale: Map epidermal cell stiffness using AFM (pyrex-NC cantilevers, 0.1 N·m⁻¹ spring constant; 10 μm·s⁻¹ approach) .

  • Nanoscale: Resolve cellulose microfibril spacing via grazing-incidence XRD at 15 keV (APS beamline 12-ID-D) .

Data Correlation:

  • EXLA1-mediated CW loosening should concurrently reduce AFM Young’s modulus (↓20–40%) and increase microfibril spacing (↑1.5–2.0 nm) .

Methodological Recommendations for Contradictory Data

Case Study: Conflicting reports on whether EXLA1 enhances or inhibits fungal pathogen resistance.

Resolution Protocol:

  • Pathogen specificity: Test multiple isolates (e.g., Botrytis cinerea B05.10 vs. Colletotrichum higginsianum IMI 349063).

  • Spatiotemporal resolution: Image EXLA1::GUS staining at infection sites (12–72 h post-inoculation).

  • CW immunity markers: Quantify callose (aniline blue), lignin (phloroglucinol), and ROS (DAB staining) in guard cells .

Unified Model: EXLA1 may promote early CW remodeling (↑susceptibility) while priming late defense responses (↓disease spread), explaining divergence across studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.