Recombinant Arabidopsis thaliana F-box only protein 12 (FBX12)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
FBX12; At1g30935; F17F8.20; F-box only protein 12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-404
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
FBX12
Target Protein Sequence
MKNSIPIDLIYEILSRLPAKSVARCRCVSKRWRSILRHQVFTELFLTRSNARPRLLIGVQ QDGEWSFLSTPQPQNRHESSSLVVAAADFHTKFSSGKSRHQCTYASGGSYSYLGFDPIDK EFKVLFMDTCDFIASKDEDHYILTLGTGELKWRKIQCPFTHEPFWERICINGVLYYSAYY SDSNGRSHLIACFDVRSEKFNFIATKHRYDQLINYKGKLCGINLEYARHVGGFPVKLSMW VLEDVEKPEWSKHVYSLWTESEVVKVNRNLSVSGMTATGDIVLSMEDATNPFYVFNFNPD RNTLQVQSVEIQGLGANRDHIACHAFVDYVEDFSVSDAVLQLKSSPLQQQGQDTSHDLSK SVKNKQLDNYEFLANKLNHSVSLAILFCLFFLLFNYLIRLCWVR
Uniprot No.

Target Background

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

Basic Understanding of FBX12 and F-box Proteins

  • What is Arabidopsis thaliana F-box only protein 12 (FBX12) and how does it function in plants?

    F-box only protein 12 (FBX12) is a member of the expansive F-box protein family in Arabidopsis thaliana, characterized by its N-terminal F-box domain. Like other F-box proteins, FBX12 is likely to function as a component of SCF (SKP1-CUL1-F-box) E3 ubiquitin ligase complexes that target specific proteins for ubiquitination and subsequent degradation by the 26S proteasome. The "F-box only" designation indicates that beyond the F-box domain, this protein lacks other recognizable functional domains found in other F-box protein subfamilies (such as LRR, Kelch, or FBA domains) .

  • How does FBX12 integrate into the broader F-box protein family in Arabidopsis thaliana?

    Arabidopsis thaliana contains approximately 700 F-box proteins, making it one of the largest gene families in plants . Based on structural analysis, FBX12 belongs to the subset of F-box proteins that contain primarily the F-box domain without additional recognized domains like LRR (Leucine-Rich Repeats), Kelch repeats, or FBA (F-Box Associated) domains that are found in other family members. This positions FBX12 in a distinct functional category compared to more complex F-box proteins like FBL17, which are involved in specific cellular processes such as cell cycle regulation .

  • What is the significance of the SCF complex in plant development and how does FBX12 potentially contribute?

    SCF complexes are critical E3 ubiquitin ligases involved in numerous developmental and physiological processes in plants. These complexes consist of four primary components: SKP1 (ASK proteins in Arabidopsis), CUL1 (Cullin), an F-box protein, and RBX1. The F-box protein, such as FBX12, provides substrate specificity by recognizing and binding target proteins for ubiquitination.

    SCF complexes regulate diverse processes including cell cycle progression, hormone signaling, stress responses, and gametophyte development. While FBX12's specific functions await full characterization, by analogy with other F-box proteins like FBL17 (which regulates male gametogenesis), FBX12 likely targets specific proteins for degradation, thereby influencing particular developmental pathways or stress responses .

  • How do ASK proteins interact with F-box proteins in Arabidopsis, and what might this tell us about FBX12?

    The Arabidopsis genome encodes 21 different ASK (Arabidopsis SKP-Like) proteins that can potentially interact with F-box proteins to form functional SCF complexes . Comprehensive analysis using yeast two-hybrid assays has shown that individual F-box proteins can interact with multiple ASK proteins, with interaction preferences often correlating with the specific domains the F-box protein contains .

    While FBX12-specific interaction data may be limited, research on other F-box proteins suggests that FBX12 likely interacts with a subset of ASK proteins to form distinct SCF complexes. These interactions are potentially tissue-specific and developmentally regulated, with particular abundance in tissues related to male gametophyte and seed development .

  • What are the expression patterns of F-box genes in Arabidopsis, and how might FBX12 expression be regulated?

    F-box genes in Arabidopsis show diverse expression patterns, with some being constitutively expressed while others show tissue-specific or condition-dependent expression. Many F-box proteins, like FBL17, show cell cycle-dependent expression patterns and can be regulated by transcription factors such as E2F .

    Based on patterns observed with other F-box proteins, FBX12 expression may be regulated by specific transcription factors and could vary across different tissues and developmental stages. The expression may also respond to environmental cues such as stress conditions, as seen with other F-box proteins involved in stress responses .

Advanced Research Questions

  • How can researchers identify potential substrates of FBX12 in the SCF complex?

    Identifying substrates of F-box proteins involves multiple complementary approaches:

    1. Co-immunoprecipitation coupled with mass spectrometry: Using tagged FBX12 to pull down interacting proteins, followed by mass spectrometry identification.

    2. Yeast two-hybrid screens: While also used to study F-box-ASK interactions, Y2H can identify potential substrates when using the substrate-binding domain of FBX12 .

    3. Protein stability assays: Examining protein degradation patterns in wild-type versus FBX12 knockout plants can reveal stabilized proteins (potential substrates).

    4. Ubiquitination assays: In vitro ubiquitination assays with reconstituted SCF^FBX12 complexes and candidate substrates.

    When analyzing potential substrates, researchers should consider the likelihood of condition-specific interactions, as many F-box proteins recognize their substrates only after the substrates have been modified (e.g., phosphorylated) under specific conditions .

  • What experimental approaches are most effective for studying FBX12 function in vivo?

    Based on successful approaches with other F-box proteins, the following methodologies are recommended:

    ApproachMethodologyAdvantagesConsiderations
    Gene knockoutT-DNA insertion lines or CRISPR/Cas9Direct assessment of loss-of-function phenotypesPotential genetic redundancy may mask phenotypes
    Tissue-specific expression analysisqRT-PCR, RNA-seq, or promoter:GUS/GFP fusionsReveals spatial and temporal expression patternsRequires careful tissue sampling and controls
    Protein localizationFluorescent protein fusions observed via confocal microscopyProvides subcellular localization dataFusion proteins may alter normal localization
    Protein-protein interactionsCo-IP, BiFC, or Y2H assaysIdentifies interaction partnersIn vitro interactions may not reflect in vivo conditions
    Phenotypic analysisDetailed physiological and developmental analysisLinks gene function to observable traitsEnvironmental variables may influence phenotypes

    As demonstrated with other F-box proteins like those tested in the drought study, examining phenotypes under specific stress conditions can reveal conditional functions that might not be apparent under standard growth conditions .

  • How does protein domain architecture influence FBX12 function and interactions?

    The domain architecture of F-box proteins critically determines their interaction capabilities and substrate specificity. Research on F-box proteins has revealed that domains like FBA, Kelch, and LRR influence which ASK proteins they interact with .

    As an F-box only protein, FBX12 lacks these additional recognized domains, which may result in:

    1. A potentially different pattern of ASK protein interactions compared to F-box proteins with additional domains

    2. Unique substrate recognition mechanisms that don't rely on common protein-protein interaction domains

    3. Possibly more specific or restricted substrate range

    Researchers should consider employing structural biology approaches (X-ray crystallography or cryo-EM) to elucidate the precise structural features that enable FBX12 to recognize its substrates despite lacking common interaction domains .

  • What role might FBX12 play in environmental stress responses in Arabidopsis?

    F-box proteins often participate in plant responses to environmental stresses. While FBX12-specific data may be limited, research on other F-box proteins provides insights into potential roles:

    Recent research using T-DNA knockout lines has demonstrated that certain F-box genes show significant genotype-by-environment (GxE) interactions under stress conditions like drought . For example, wrky38 mutants exhibited GxE effects for fitness under drought conditions .

    To investigate FBX12's potential role in stress responses, researchers should:

    1. Examine FBX12 expression under various stress conditions

    2. Test FBX12 knockout lines under multiple stress conditions (drought, cold, salt, pathogen)

    3. Analyze natural variation in FBX12 sequences across Arabidopsis accessions from different environments

    4. Look for potential GxE interactions that might reveal conditional phenotypes only visible under specific stresses

  • How can researchers effectively study tissue-specific roles of FBX12 in plant development?

    Research on other F-box proteins like FBL17 has demonstrated critical tissue-specific functions, particularly in male gametophyte development. FBL17 is essential for pollen mitosis II, and its loss results in bicellular pollen and embryo abortion .

    To investigate tissue-specific roles of FBX12, researchers should consider:

    1. Tissue-specific expression analysis: Using qRT-PCR, RNA-seq, or promoter:GUS fusions to determine precise expression patterns.

    2. Tissue-specific knockout or knockdown: Using tissue-specific promoters driving CRISPR/Cas9 or RNAi constructs.

    3. Detailed phenotypic analysis: Examining specific tissues in knockout plants, with particular attention to male and female gametophyte development, pollen function, seed development, and other developmental processes where F-box proteins are known to play important roles.

    4. Cell-type specific interactome studies: Identifying tissue-specific interaction partners that might reveal context-dependent functions .

Experimental Methods and Technical Considerations

  • What are the optimal conditions for recombinant expression and purification of FBX12?

    Based on successful approaches with other F-box proteins, recommended strategies include:

    1. Expression system selection:

      • E. coli: BL21(DE3) or Rosetta strains with pET vectors for basic studies

      • Insect cells (Sf9, High Five) for more complex applications requiring post-translational modifications

      • Plant-based expression systems for native conformations

    2. Fusion tags and constructs:

      • N-terminal 6xHis or GST tags generally preserve F-box protein functionality

      • Consider TEV protease cleavage sites for tag removal

      • Express both full-length protein and the substrate-binding region separately

    3. Expression conditions:

      • For E. coli: Induction at OD600 ~0.6-0.8 with 0.1-0.5 mM IPTG

      • Lower temperature (16-20°C) expression often improves solubility

      • Co-expression with ASK proteins may enhance solubility and stability

    4. Purification strategy:

      • Two-step purification (affinity chromatography followed by size exclusion)

      • Include protease inhibitors throughout purification

      • Maintain reducing conditions (1-5 mM DTT or 2-10 mM β-mercaptoethanol)

      • Optimize salt concentration (typically 150-300 mM NaCl) to maintain solubility

    5. Storage considerations:

      • Store in buffer containing 10-20% glycerol at -80°C

      • Avoid repeated freeze-thaw cycles

      • Test protein activity after storage to ensure functionality is preserved

  • How can researchers optimize yeast two-hybrid assays for studying FBX12 interactions?

    Yeast two-hybrid (Y2H) assays have been successfully used to study F-box protein interactions with ASK proteins in Arabidopsis . For FBX12 interaction studies, researchers should consider these optimizations:

    1. Bait and prey construction:

      • Use full-length FBX12 as bait to screen for ASK interactions

      • For substrate screening, consider using C-terminal domain (without F-box) to prevent interference from endogenous yeast SCF machinery

      • Test for auto-activation and toxicity before main screens

    2. Yeast strain selection:

      • AH109 or Y2HGold strains provide multiple reporters for interaction verification

      • Consider NMY51 or THY.AP4 for membrane-associated interactions if relevant

    3. Screening conditions:

      • Use graduated selection stringency (SD/-Leu/-Trp followed by SD/-Leu/-Trp/-His/-Ade)

      • Include 3-AT at optimized concentrations to reduce background

      • Validate interactions bidirectionally by swapping bait and prey constructs

    4. Controls and validation:

      • Include known F-box-ASK interactions as positive controls

      • Test interactions with multiple ASK proteins to establish specificity profiles

      • Confirm interactions using alternative methods (pull-down assays, BiFC, co-IP)

  • What are the key considerations for designing knockout experiments to study FBX12 function?

    When designing knockout experiments to study FBX12 function, researchers should consider:

    1. Knockout strategy selection:

      • T-DNA insertion lines: Select lines with insertions in exons for maximal disruption

      • CRISPR/Cas9: Design guides targeting early exons to create frameshift mutations

      • Verify homozygosity and confirm knockout at both transcript and protein levels

    2. Experimental design:

      • Include appropriate wild-type controls from the same background

      • Consider multiple environmental conditions to reveal conditional phenotypes

      • Design experiments with sufficient statistical power (≥7 replicates per condition)

    3. Phenotypic analysis:

      • Examine multiple developmental stages

      • Assess both vegetative and reproductive phenotypes

      • Measure quantitative traits (growth parameters, fitness components)

      • Document phenotypes under normal and stress conditions

    4. Genetic redundancy considerations:

      • Identify close homologs that might compensate for FBX12 loss

      • Consider generating double or higher-order mutants if single mutants show subtle phenotypes

      • Use artificial microRNAs for knocking down multiple family members simultaneously

    5. Data interpretation:

      • Distinguish between direct and indirect effects of gene knockout

      • Consider developmental context of observed phenotypes

      • Relate phenotypes to known F-box protein functions in similar contexts

  • How can researchers effectively analyze the evolutionary relationships of FBX12 with other F-box proteins?

    To analyze evolutionary relationships of FBX12 with other F-box proteins, researchers should:

    1. Sequence retrieval and alignment:

      • Collect FBX12 homologs from diverse plant species

      • Perform multiple sequence alignment focusing on conserved regions

      • Consider structural alignment for more divergent sequences

    2. Phylogenetic analysis:

      • Use maximum likelihood or Bayesian methods for tree construction

      • Employ appropriate evolutionary models (JTT, WAG, or LG for proteins)

      • Assess node support with bootstrap or posterior probability values

      • Root trees using ancestral F-box proteins or outgroups

    3. Domain architecture analysis:

      • Compare domain organization across homologs

      • Identify lineage-specific domain gains or losses

      • Analyze selective pressure on different protein regions (dN/dS ratios)

    4. Comparative genomic context:

      • Examine synteny around FBX12 homologs

      • Identify gene duplication or loss events

      • Consider whole genome duplication events in evolutionary history

    5. Correlate with functional divergence:

      • Compare expression patterns of homologs across species

      • Analyze natural variation within species (as done for other F-box genes)

      • Consider potential subfunctionalization or neofunctionalization events

  • What are the most reliable methods for studying subcellular localization of FBX12?

    For studying FBX12 subcellular localization, researchers should consider:

    1. Fluorescent protein fusions:

      • C-terminal GFP/YFP fusions typically preserve F-box protein functionality

      • Test both N- and C-terminal fusions to ensure tags don't disrupt localization signals

      • Use native promoters when possible to maintain physiological expression levels

      • Consider photoconvertible fluorescent proteins (e.g., mEos) for dynamic studies

    2. Expression systems:

      • Transient expression in Arabidopsis protoplasts for rapid screening

      • Stable transformation for tissue-specific and developmental studies

      • Use inducible promoters to control expression timing and avoid artifacts from overexpression

    3. Co-localization studies:

      • Include organelle markers (e.g., nuclear, ER, Golgi, cytoskeletal markers)

      • Co-express with known interacting partners (ASK proteins) to assess co-localization

      • Use BiFC to simultaneously visualize protein-protein interactions and localization

    4. Advanced microscopy techniques:

      • Confocal microscopy for standard localization

      • Super-resolution microscopy for precise sub-organelle localization

      • FRAP (Fluorescence Recovery After Photobleaching) for protein mobility analysis

      • Live-cell imaging to track dynamic changes in localization

Data Analysis and Integration

  • How can proteomics approaches be integrated with functional studies of FBX12?

    Integrating proteomics with functional studies provides powerful insights into FBX12 function:

    1. Quantitative proteomics approaches:

      • SILAC or TMT labeling to compare proteomes between wild-type and FBX12 knockout plants

      • Identify proteins that accumulate in knockouts (potential substrates)

      • Analyze ubiquitinome changes using ubiquitin remnant profiling

      • Time-course experiments to capture dynamic changes in the proteome

    2. Interactome analysis:

      • Immunoprecipitation followed by mass spectrometry (IP-MS)

      • Proximity labeling techniques (BioID, TurboID) to identify proteins in close proximity

      • Crosslinking mass spectrometry (XL-MS) to map interaction interfaces

      • Compare interactomes under different conditions to identify context-specific interactions

    3. Data integration and analysis:

      • Correlate proteomics data with transcriptomics to distinguish between transcriptional and post-transcriptional regulation

      • Network analysis to place identified proteins in biological pathways

      • Gene Ontology enrichment to identify biological processes affected by FBX12

      • Motif analysis to identify potential recognition sequences in substrates

    4. Validation strategies:

      • Confirm direct interactions with candidate substrates

      • Verify ubiquitination of candidate substrates in vitro and in vivo

      • Test protein stability of candidates in wild-type versus knockout backgrounds

      • Perform genetic interaction tests between FBX12 and candidate substrates

  • What computational approaches can predict FBX12 function and interactions?

    Computational approaches offer valuable insights into potential FBX12 functions:

    1. Sequence-based predictions:

      • Identify conserved motifs or residues through multiple sequence alignments

      • Predict post-translational modification sites that might regulate FBX12

      • Use protein disorder prediction to identify flexible regions potentially involved in protein-protein interactions

      • Employ machine learning algorithms trained on known F-box proteins to predict functions

    2. Structural modeling and analysis:

      • Generate homology models based on crystal structures of related F-box proteins

      • Identify potential substrate-binding surfaces through structural analysis

      • Use molecular docking to predict interactions with ASK proteins and potential substrates

      • Molecular dynamics simulations to study binding dynamics and conformational changes

    3. Network-based approaches:

      • Construct co-expression networks to identify genes with similar expression patterns

      • Integrate protein-protein interaction data to place FBX12 in cellular networks

      • Perform guilt-by-association analysis to infer functions from network neighbors

      • Use network propagation algorithms to extend known interactions to potential new ones

    4. Comparative genomics:

      • Analyze conservation patterns across species to identify functionally important regions

      • Examine co-evolution patterns that might indicate functional relationships

      • Analyze natural variation in FBX12 sequences across Arabidopsis accessions to identify potentially adaptive variants

      • Compare syntenic regions around FBX12 loci across species to infer evolutionary history

  • How can researchers integrate FBX12 studies with broader plant development and stress response networks?

    Integrating FBX12 studies into broader networks requires:

    1. Multi-omics data integration:

      • Combine transcriptomics, proteomics, and metabolomics data

      • Use FBX12 knockout/overexpression lines as perturbation systems

      • Compare data across multiple tissues, developmental stages, and stress conditions

      • Employ systems biology modeling approaches to understand network dynamics

    2. Pathway and process integration:

      • Connect FBX12 function to known developmental and stress response pathways

      • Examine phenotypes in the context of hormone signaling networks

      • Analyze potential roles in cell cycle regulation by comparison with well-studied F-box proteins like FBL17

      • Consider connections to ubiquitin-proteasome system regulation

    3. Genetic interaction studies:

      • Construct double mutants with genes in relevant pathways

      • Perform genetic suppressor screens to identify downstream components

      • Use CRISPR interference or activation screens to identify genetic interactions

      • Analyze conditional genetic interactions under various stress conditions

    4. Translational approaches:

      • Compare function with homologs in crop species

      • Assess potential agricultural applications based on stress response roles

      • Consider breeding applications if natural variation affects agronomically important traits

      • Develop molecular markers based on natural variation data

  • What methodology is most effective for studying the role of FBX12 in plant responses to environmental stresses?

    For studying FBX12 in stress responses, researchers should consider:

    1. Stress treatment protocols:

      Stress TypeRecommended ProtocolKey MeasurementsControls
      DroughtProgressive soil drying with monitored water contentPhysiological parameters, fitness componentsWell-watered controls, known drought-responsive mutants
      TemperatureControlled temperature regimes with gradual acclimationGrowth parameters, reproductive successWild-type at optimal temperature, known temperature-sensitive mutants
      SaltGradual salt application to avoid shock responsesIon content, growth metricsNo-salt controls, known salt-sensitive mutants
      PathogenControlled inoculation with quantified pathogen loadDisease progression, defense gene expressionMock-inoculated controls, known defense mutants
    2. Experimental design considerations:

      • Use standardized growth conditions before applying stress

      • Include appropriate positive controls (known stress-responsive mutants)

      • Design time-course experiments to capture dynamic responses

      • Consider combinatorial stresses that better mimic field conditions

      • Include recovery phases to assess resilience

    3. Phenotypic and molecular analysis:

      • Measure both immediate responses and long-term adaptation

      • Assess impacts on growth, development, and reproductive success

      • Monitor gene expression changes using qRT-PCR or RNA-seq

      • Analyze protein abundance and post-translational modifications

      • Quantify metabolite changes using targeted or untargeted metabolomics

    4. Data integration approaches:

      • Compare phenotypes with those of other ubiquitin pathway mutants

      • Integrate with transcriptome data from public repositories

      • Analyze natural variation in stress responses across accessions

      • Consider evolutionary aspects of stress adaptation mechanisms

  • How can the function of FBX12 be compared with other well-characterized F-box proteins like FBL17?

    To effectively compare FBX12 with other F-box proteins like FBL17, researchers should:

    1. Functional comparison framework:

      • Compare expression patterns across tissues and developmental stages

      • Analyze knockout phenotypes under similar conditions

      • Compare interaction profiles with ASK proteins using consistent methodologies

      • Assess substrate specificities through complementary approaches

    2. Structural and evolutionary comparisons:

      • Analyze domain architectures and their implications for function

      • Compare sequence conservation in the F-box domain and substrate recognition regions

      • Assess evolutionary history and selection pressures

      • Examine functional divergence following gene duplication events

    3. Comparative analysis with FBL17:

      • FBL17 is cell cycle-regulated and E2F-responsive

      • FBL17 plays a critical role in male gametogenesis, specifically in pollen mitosis II

      • FBL17 interacts strongly with ASK11, forming a novel SCF complex type

      • Compare these specific characteristics with FBX12 to identify similarities and differences

    4. Methodology standardization:

      • Use consistent experimental platforms across proteins

      • Apply identical analysis pipelines to raw data

      • Design parallel experimental conditions for direct comparisons

      • Develop quantitative metrics for comparing functional importance across pathways

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.