Recombinant Arabidopsis thaliana F-box protein At1g56610 (At1g56610)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your use.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and inherent protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
At1g56610; F25P12.94; F-box protein At1g56610
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-535
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At1g56610
Target Protein Sequence
MGFALVLIFLFGFYLFLMKSSSIFPQRPFTFLYDLWVLLLVLRFLFSLIQILILCLFNFR FVEMTSNNKKKKTELCDLPKCLAPHILSWLPTKTAVTVSLLFMKGWWRSEMKNLSSLKFS FSDDQEEEHFVRFVDQVLRQRGNRKLDSFSLTLNDEIDGGFVTHLVDYPLDNGVEKLKLS IYDIKGNFQLSSRVFSQATLVTLKLATNRSLIWINGDDVAAAHLPCLKTLWLDDVLVADV KVFVRLLSRCPILEELVMIDMKWHNWEACFVVSASLRRLKIVWTDYVEMDEYDRCPQSVL FDTPNVLYLEYTDHIAGQYPLLKFSSLIEAKIRLEMIDEKEEEDEGQEVIVGDNATAFIT GITSVRKLYLYANTIQVLHHYFDPPIPEFVYLTHLTIQSDKELGWDAIPELLSKCPHLET LVLEGLFHLATDVCGDVCPCRRNMEQAISYLVKSPVTHLEIYEGVVGKKRGEVTEDAARF GEQVRWFLMRMLHLQQVKIYGQTEDSVTALYDIATELRRLEGKASPNVQISVLQA
Uniprot No.

Target Background

Function
A component of SCF (SKP1-Cullin-F-box) E3 ubiquitin ligase complexes, this protein likely mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
Database Links

KEGG: ath:AT1G56610

UniGene: At.20575

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the Arabidopsis thaliana F-box protein At1g56610?

At1g56610 is an F-box protein encoded in the Arabidopsis thaliana genome, identified in various phosphoproteomic studies. It contains the characteristic F-box domain that typically functions in protein-protein interactions, particularly as components of SCF (Skp1-Cullin-F-box) ubiquitin ligase complexes. These complexes play crucial roles in targeted protein degradation via the ubiquitin-proteasome pathway. The protein has been identified in phosphoproteomic analyses with a phosphorylation site characterized by the peptide sequence VFS(ph)QATLVTLK, with a regulation value of -0.73 under certain experimental conditions . The phosphorylation status of this protein may be important in regulating its activity, stability, or interactions with other proteins in signaling pathways.

How is At1g56610 typically expressed in Arabidopsis thaliana tissues?

The expression of At1g56610 varies across different tissues and developmental stages in Arabidopsis thaliana. To study its expression pattern, researchers commonly employ several methodologies:

  • Transcriptional analysis: RT-PCR and qPCR techniques using gene-specific primers to quantify mRNA expression levels across different tissues.

  • Promoter-reporter fusion: Creating transgenic plants with the At1g56610 promoter fused to reporter genes like GUS or fluorescent proteins to visualize tissue-specific expression patterns.

  • RNA-seq data analysis: Analyzing publicly available transcriptome datasets from resources like TAIR or NCBI GEO to compare expression levels across different tissues, developmental stages, and stress conditions.

Expression studies should include multiple biological replicates and appropriate statistical analysis to account for natural variation. When investigating tissue-specific expression, researchers should consider examining roots, shoots, leaves, flowers, and seeds at various developmental stages to create a comprehensive expression profile.

What are the best methods for recombinant expression of At1g56610?

For successful recombinant expression of At1g56610, consider the following methodological approach:

Expression Systems Options:

SystemAdvantagesDisadvantagesBest For
E. coliFast growth, high yield, inexpensiveMay lack proper post-translational modificationsInitial structural studies, antibody production
Insect cellsBetter post-translational modificationsMore expensive, longer production timeFunctional studies requiring proper folding
Plant expression systemsNative post-translational modificationsLower yield, time-consumingInteraction studies, in planta function

When expressing At1g56610 in recombinant systems, researchers should first analyze the protein sequence for potential challenges such as codon bias, hydrophobic regions, and post-translational modifications. For bacterial expression, optimization may include using strains like BL21(DE3) with codon optimization and fusion tags (His, GST, MBP) to improve solubility. Temperature, IPTG concentration, and induction time should be optimized through small-scale expression trials before scaling up .

If bacterial expression proves challenging, consider using a glycoengineered mammalian cell line approach similar to that used for other recombinant proteins, which can provide proper glycosylation and phosphorylation patterns critical for protein function .

How can I verify the phosphorylation status of At1g56610?

The phosphorylation of At1g56610 at the serine residue within the VFS(ph)QATLVTLK peptide can be verified through several complementary approaches:

  • Mass spectrometry analysis: Purify the protein from plant tissue or recombinant systems and perform LC-MS/MS analysis. Look specifically for the phosphorylated peptide VFS(ph)QATLVTLK identified in previous studies .

  • Phospho-specific antibodies: Generate antibodies against the phosphorylated peptide sequence for use in Western blotting or immunoprecipitation.

  • Phosphatase treatment assays: Treat purified protein with lambda phosphatase and compare migration patterns on SDS-PAGE or Phos-tag gels to determine if phosphorylation affects mobility.

  • Site-directed mutagenesis: Create serine-to-alanine (prevents phosphorylation) or serine-to-aspartate (phosphomimetic) mutations at the phosphorylation site to study functional consequences.

For mass spectrometry verification, employ enrichment strategies such as immobilized metal affinity chromatography (IMAC) or titanium dioxide (TiO₂) to concentrate phosphopeptides before analysis. Analysis should include both identification of the phosphorylation site and relative quantification compared to the non-phosphorylated form.

What experimental approaches best determine the substrates of At1g56610 F-box protein in the SCF complex?

To identify the substrates of At1g56610 as part of an SCF complex, implement a multi-faceted experimental strategy:

  • Proximity-dependent biotin labeling: Express At1g56610 fused to BioID or TurboID in Arabidopsis cells, allowing biotinylation of proteins in close proximity. After affinity purification of biotinylated proteins, perform mass spectrometry to identify potential substrates.

  • Co-immunoprecipitation coupled with proteomics: Express epitope-tagged At1g56610 in Arabidopsis, perform immunoprecipitation under various conditions, and identify interacting proteins by mass spectrometry.

  • Yeast two-hybrid screens: Use At1g56610 as bait to screen Arabidopsis cDNA libraries for interacting proteins, with validation through secondary assays.

  • Substrate trapping: Create a dominant-negative version of the F-box protein by mutating critical residues or employ proteasome inhibitors to stabilize substrate interactions.

  • Comparative proteomics: Compare the proteome of wildtype plants with At1g56610 knockouts using SILAC or TMT labeling to identify proteins that accumulate in the absence of At1g56610-mediated degradation.

Validation of identified substrates should include confirming direct interaction, demonstrating ubiquitination in vitro and in vivo, and showing that substrate stability increases in plants lacking functional At1g56610. Additionally, examine if the regulatory value of -0.73 observed in phosphoproteomic studies affects substrate recognition.

How does phosphorylation affect At1g56610 function and protein interactions?

The phosphorylation of At1g56610 at the VFS(ph)QATLVTLK site likely serves as a regulatory mechanism affecting protein function and interactions. To investigate this relationship:

  • Structural analysis: Create homology models of At1g56610 in phosphorylated and non-phosphorylated states to predict how phosphorylation might alter protein conformation. Consider using approaches similar to those used for modeling the AHK1-ED structure .

  • Phosphorylation-dependent interaction studies: Compare protein interactions of wild-type, phosphomimetic (S→D), and phospho-dead (S→A) versions of At1g56610 using techniques such as:

    • Co-immunoprecipitation with known SCF components

    • Yeast two-hybrid assays under different conditions

    • Surface plasmon resonance to measure binding kinetics

  • Functional complementation assays: Transform At1g56610 knockout plants with wild-type, phosphomimetic, and phospho-dead versions of At1g56610 to determine if phosphorylation status affects phenotypic rescue.

  • Phosphorylation dynamics: Analyze how different stresses or developmental stages affect At1g56610 phosphorylation using targeted phosphoproteomics.

  • Protein stability and localization: Determine if phosphorylation affects protein half-life, subcellular localization, or incorporation into SCF complexes.

To connect phosphorylation status with specific signaling pathways, consider analyzing At1g56610 phosphorylation in response to treatments such as 0.3M mannitol (10 minutes) or various hormonal treatments, following approaches similar to those used in other Arabidopsis phosphoproteomic studies.

What phenotypic changes are observed in At1g56610 knockout or overexpression lines?

To characterize the physiological role of At1g56610, comprehensive phenotypic analysis of genetic modification lines should include:

Methodological approach for phenotyping:

  • Generation of genetic material:

    • Create multiple independent knockout lines using CRISPR-Cas9 or T-DNA insertion

    • Develop overexpression lines using constitutive (35S) and inducible promoters

    • Generate complementation lines with wildtype, phosphomimetic, and phospho-dead versions

  • Growth and developmental phenotyping:

    • Root architecture analysis including primary root length, lateral root development, and gravitropic response

    • Hypocotyl elongation under different light conditions and temperatures

    • Germination rate under normal and stress conditions

    • Flowering time and reproductive development

  • Stress response analysis:

    • Osmotic stress tolerance (similar to mannitol treatments used in other studies)

    • Temperature sensitivity (similar to the approach used for studying temperature responses in Arabidopsis)

    • Hormonal responses (examining sensitivity to auxin, brassinosteroids, abscisic acid)

  • Molecular phenotyping:

    • Transcriptome analysis of knockout vs. wildtype plants under normal and stress conditions

    • Proteomic profiling to identify accumulated proteins in knockout lines

    • Analysis of ubiquitination patterns in knockout vs. wildtype plants

When analyzing results, consider that F-box proteins often show subtle phenotypes due to functional redundancy. Statistical analysis should include multiple biological replicates and appropriate statistical tests to account for natural variation.

How can contradictory experimental results regarding At1g56610 function be reconciled?

When faced with contradictory results in At1g56610 research, employ these methodological approaches to resolve discrepancies:

  • Experimental condition standardization: Carefully define and control experimental conditions, as minor variations can significantly impact results. Consider the following factors:

    • Growth conditions (temperature, light intensity, photoperiod)

    • Plant age and developmental stage

    • Media composition and pH

    • Treatment duration and intensity

    For example, research has shown that temperature variations can significantly affect phenotypic outcomes in Arabidopsis mutants, as demonstrated in studies where temperature influenced hypocotyl elongation phenotypes .

  • Genetic background considerations:

    • Examine whether contradictory results come from different Arabidopsis ecotypes

    • Perform complementation tests to confirm phenotypes are due to the gene of interest

    • Create knockouts in multiple ecotypes to test background effects

    Studies have shown that phenotypes can vary significantly between ecotypes like Ws-2, Nos-0, and Col-0 under identical conditions .

  • Methodological validation:

    • Employ multiple independent methods to test the same hypothesis

    • Validate antibody specificity and reagent quality

    • Utilize appropriate positive and negative controls

  • Statistical rigor:

    • Ensure sufficient biological and technical replicates

    • Apply appropriate statistical tests

    • Consider meta-analysis approaches when comparing across studies

  • Integration with systems biology:

    • Place contradictory results within the context of known regulatory networks

    • Consider compensatory mechanisms and functional redundancy

    • Use mathematical modeling to predict conditions under which different outcomes might occur

A systematic approach to resolving contradictions should consider that At1g56610 function may be highly context-dependent, similar to how AHK1 was found to act as a positive regulator of osmoregulation under specific defined conditions but showed variable results under different conditions .

What are the most effective approaches for studying At1g56610 protein-protein interactions in planta?

To effectively study At1g56610 protein interactions in their native context:

  • In planta co-immunoprecipitation (Co-IP):

    • Express epitope-tagged At1g56610 (HA, FLAG, GFP) under native or inducible promoters

    • Perform Co-IP followed by Western blotting for suspected interactors

    • Scale up for Co-IP-MS to identify novel interactors

    • Consider crosslinking to stabilize transient interactions

  • Förster resonance energy transfer (FRET):

    • Create fusion proteins with appropriate fluorophore pairs (e.g., CFP-At1g56610 and YFP-interactor)

    • Measure FRET efficiency in different cellular compartments

    • Perform acceptor photobleaching FRET for quantitative measurements

    • Use in combination with bimolecular fluorescence complementation (BiFC)

  • Split luciferase complementation assay:

    • Fuse At1g56610 and potential interactor to complementary luciferase fragments

    • Measure reconstituted luciferase activity in intact plants

    • Monitor interactions dynamically in response to stimuli

  • Proximity labeling in planta:

    • Express At1g56610 fused to BioID2 or TurboID under native promoter

    • Perform biotin labeling in intact plants under various conditions

    • Identify biotinylated proteins through streptavidin pulldown and MS

  • Mating-based split-ubiquitin assay:

    • Adapt the split-ubiquitin system used for studying multistep phosphorelay system components

    • Test interactions between At1g56610 and candidates in a yeast system before confirming in planta

For subcellular localization studies, combine fluorescent protein tagging with co-localization studies using compartment markers, similar to approaches used for localizing AHK1-GFP and other fusion proteins . Time-course experiments capturing protein dynamics during stress responses or developmental transitions can provide valuable insights into the regulation of At1g56610 interactions.

What are common pitfalls in recombinant At1g56610 expression and purification?

When working with recombinant At1g56610, researchers frequently encounter these challenges and solutions:

  • Low expression levels:

    • Optimize codon usage for expression system

    • Test multiple fusion tags (His, GST, MBP, SUMO) to improve solubility

    • Screen expression conditions (temperature, induction time, media composition)

    • Consider glycoengineered cell lines for mammalian expression, similar to approaches used for other recombinant proteins

  • Protein insolubility:

    • Add solubilizing agents (low concentrations of urea, non-ionic detergents)

    • Express the protein as domains rather than full-length

    • Co-express with interacting partners or chaperones

    • Use refolding protocols if expression in inclusion bodies is unavoidable

  • Proteolytic degradation:

    • Add protease inhibitors throughout purification

    • Remove flexible linkers that may be susceptible to proteolysis

    • Optimize buffer conditions (pH, salt concentration, reducing agents)

    • Perform purification at 4°C and minimize handling time

  • Poor yield after purification:

    • Implement multiple purification steps (affinity, ion exchange, size exclusion)

    • Optimize elution conditions to maximize recovery

    • Test different buffer compositions for stability during storage

    • Consider batch purification instead of column chromatography for initial capture

  • Loss of functional activity:

    • Test activity immediately after purification

    • Identify stabilizing additives (glycerol, specific ions, reducing agents)

    • Store protein in small aliquots to avoid freeze-thaw cycles

    • Characterize post-translational modifications important for function

When troubleshooting, systematically test each variable while keeping others constant. Document all conditions and results carefully to identify patterns. Consider using recombinant expression platforms that maintain relevant post-translational modifications, particularly phosphorylation at the VFS(ph)QATLVTLK site .

How can I optimize immunoprecipitation of At1g56610 for interaction studies?

Optimizing immunoprecipitation (IP) of At1g56610 requires attention to several critical parameters:

  • Antibody selection and validation:

    • Generate specific antibodies against unique epitopes of At1g56610

    • Validate antibody specificity using knockout lines as negative controls

    • Consider epitope-tagging (HA, FLAG, GFP) if specific antibodies are unavailable

    • Test antibody performance in Western blot before attempting IP

  • Cell lysis and extraction optimization:

    • Test multiple lysis buffers varying in detergent type and concentration (NP-40, Triton X-100, CHAPS)

    • Optimize salt concentration to maintain interactions while reducing non-specific binding

    • Include protease and phosphatase inhibitors to preserve protein integrity and modification status

    • Consider crosslinking for transient or weak interactions

  • IP conditions:

    • Determine optimal antibody-to-lysate ratio through titration experiments

    • Compare direct antibody conjugation to beads versus protein A/G approaches

    • Optimize incubation time and temperature (4°C overnight versus shorter room temperature incubations)

    • Test various washing stringencies to balance between maintaining interactions and reducing background

  • Controls and validation:

    • Always include negative controls (IgG, knockout plant extracts)

    • Perform reverse IP when possible to confirm interactions

    • Validate interactions through orthogonal methods (Y2H, FRET, BiFC)

    • Consider competition assays with excess peptide to demonstrate specificity

  • Specialized techniques for challenging interactions:

    • Use formaldehyde or DSP crosslinking for transient interactions

    • Employ proximity labeling approaches (BioID, APEX) as alternatives

    • Consider membrane-specific solubilization strategies if At1g56610 has membrane associations

    • Test two-step IP protocols for improved specificity in complex mixtures

When optimizing At1g56610 immunoprecipitation specifically, consider whether phosphorylation status affects interactions, and design experiments to capture both phosphorylated and non-phosphorylated forms, building on insights from previous phosphoproteomic studies .

What are the best methods for analyzing At1g56610 gene function through CRISPR/Cas9 editing?

For effective CRISPR/Cas9 editing of At1g56610, implement this comprehensive methodology:

  • Guide RNA design and validation:

    • Design multiple sgRNAs targeting early exons of At1g56610 using tools like CRISPOR or CHOPCHOP

    • Prioritize guides with high on-target and low off-target scores

    • Validate guide efficiency using in vitro cleavage assays before plant transformation

    • Consider targeting conserved domains critical for protein function

  • Vector construction and plant transformation:

    • Use a vector system allowing expression of both Cas9 and sgRNA

    • Consider egg cell-specific or meristem-specific promoters to increase germline editing

    • Transform using floral dip method and select primary transformants

    • Screen T1 plants for editing events using PCR and sequencing

  • Mutation screening and characterization:

    • Design PCR primers flanking the target site for amplification and sequencing

    • Use restriction enzyme digestion-based screening for rapid identification of edited plants

    • Perform TIDE analysis for mixed editing events

    • Sequence multiple clones to identify specific mutation types

  • Establishing homozygous knockout lines:

    • Self-pollinate edited T1 plants and screen T2 progeny

    • Identify homozygous mutants through sequencing

    • Confirm the absence of Cas9 transgene in selected lines

    • Validate protein knockout through Western blotting

  • Functional characterization:

    • Compare multiple independent knockout lines to control for off-target effects

    • Perform complementation with wild-type At1g56610 to confirm phenotypes

    • Create phospho-mutant variants (S→A and S→D) at the VFS(ph)QATLVTLK site

    • Analyze phenotypes under various conditions, including osmotic stress and temperature variations

  • Advanced editing strategies:

    • Consider base editing or prime editing for precise mutations without double-strand breaks

    • Use CRISPR interference (CRISPRi) for temporary knockdown studies

    • Implement conditional knockout systems (e.g., heat-inducible Cas9) to study essential genes

    • Create epitope-tagged versions using homology-directed repair

When analyzing CRISPR-generated At1g56610 mutants, evaluate phenotypes across multiple environmental conditions, as protein function may be context-dependent, similar to findings for other Arabidopsis proteins under varied temperatures and osmotic conditions .

How should RNA-seq data be analyzed to identify genes regulated by At1g56610 activity?

For comprehensive RNA-seq analysis to identify At1g56610-regulated genes:

  • Experimental design considerations:

    • Compare At1g56610 knockout/knockdown lines with wild-type and complemented lines

    • Include multiple independent knockout lines to control for off-target effects

    • Consider time-course experiments following induction/repression of At1g56610

    • Design treatments that may trigger At1g56610 activity (osmotic stress, temperature changes)

  • Sample preparation and sequencing:

    • Extract RNA from developmentally matched tissues with sufficient biological replicates (minimum 3-4)

    • Verify RNA quality (RIN > 8) before library preparation

    • Sequence to adequate depth (30-50 million reads per sample) for differential expression analysis

    • Include spike-in controls for normalization

  • Primary data analysis pipeline:

    • Perform quality control using FastQC and adapter trimming if necessary

    • Align reads to Arabidopsis reference genome using STAR or HISAT2

    • Quantify gene expression using featureCounts or Salmon

    • Perform differential expression analysis using DESeq2 or edgeR

  • Advanced analytical approaches:

    • Conduct time-series analysis for temporal studies using maSigPro or ImpulseDE2

    • Perform gene set enrichment analysis (GSEA) to identify affected pathways

    • Use network analysis to identify co-regulated gene modules

    • Integrate with ChIP-seq data if available to distinguish direct from indirect targets

  • Validation and follow-up:

    • Confirm key differentially expressed genes with RT-qPCR

    • Cross-reference with proteomics data to identify post-transcriptional regulation

    • Conduct promoter analysis of regulated genes for common motifs

    • Test direct regulation using transient expression assays

For data interpretation, focus on genes showing consistent regulation across multiple knockout lines and experimental conditions. Pay particular attention to genes involved in protein degradation pathways, as F-box proteins typically function in targeted proteolysis. Consider how phosphorylation status (VFS(ph)QATLVTLK) might affect the regulatory network.

What statistical approaches are best for analyzing phosphoproteomic data related to At1g56610?

For rigorous analysis of phosphoproteomic data involving At1g56610:

  • Data preprocessing and quality control:

    • Normalize intensities using appropriate methods (global normalization, LOESS)

    • Handle missing values through imputation or specialized statistical methods

    • Assess technical and biological variation through coefficient of variation analysis

    • Filter low-quality phosphosites based on localization probability scores

  • Differential phosphorylation analysis:

    • Apply moderated t-tests with multiple testing correction (Benjamini-Hochberg)

    • Consider ANOVA for multi-condition comparisons

    • Implement linear models to account for batch effects and other covariates

    • Use specialized software (MaxQuant, Proteome Discoverer, Skyline) with appropriate statistical modules

  • Pathway and network analysis:

    • Conduct enrichment analysis specific to phosphorylation networks

    • Map phosphosites to known kinase motifs to identify responsible kinases

    • Integrate with protein-protein interaction networks

    • Perform causal network analysis to infer directionality of signaling

  • Time-course and dynamic phosphorylation analysis:

    • Apply clustering methods to identify co-regulated phosphosites

    • Use Gaussian process regression for temporal modeling

    • Implement principal component analysis to identify major patterns of variation

    • Consider partial least squares discriminant analysis for classification of phosphorylation patterns

  • Validation and interpretation:

    • Cross-validate findings using different mass spectrometry approaches

    • Confirm key phosphorylation events with phospho-specific antibodies

    • Generate and test phospho-mimetic or phospho-dead mutants

    • Interpret regulation values (such as the -0.73 value for VFS(ph)QATLVTLK) in biological context

When analyzing At1g56610 phosphorylation specifically, consider experimental designs similar to previous phosphoproteomic studies in Arabidopsis, such as the 10-minute treatment with 0.3M mannitol , to identify condition-specific phosphorylation patterns.

How can I integrate multi-omics data to better understand At1g56610 function in plant stress responses?

To effectively integrate multi-omics data for understanding At1g56610 function:

  • Data collection and harmonization:

    • Generate matched samples for transcriptomics, proteomics, phosphoproteomics, and metabolomics

    • Ensure consistent experimental conditions and timepoints across platforms

    • Include appropriate controls and sufficient biological replicates

    • Normalize and transform data to make different omics layers comparable

  • Multi-layer data integration approaches:

    • Correlation-based methods:

      • Calculate correlations between layers (e.g., transcript-protein, protein-phosphosite)

      • Identify concordant and discordant regulation patterns

      • Use weighted correlation network analysis (WGCNA) for module detection across layers

    • Pathway-based integration:

      • Map all omics data to common pathway frameworks

      • Perform integrated pathway enrichment analysis

      • Visualize multi-omics data on pathway maps using tools like PathVisio

    • Network-based approaches:

      • Construct molecular interaction networks incorporating all data types

      • Identify network modules and key regulators using algorithms like HotNet or PCSF

      • Infer causal relationships using Bayesian networks or directed random walks

  • Advanced computational methods:

    • Apply dimension reduction techniques (multi-omics factor analysis, MOFA)

    • Use tensor-based methods for three-dimensional data integration

    • Implement machine learning approaches (multi-view learning, deep neural networks)

    • Consider Bayesian data fusion for integrating heterogeneous data types

  • Biological interpretation:

    • Focus on regulatory cascades involving At1g56610

    • Identify potential substrates by correlating protein abundance with At1g56610 levels

    • Examine how phosphorylation status (VFS(ph)QATLVTLK) correlates with downstream effects

    • Compare stress responses to developmental regulation

  • Validation experiments:

    • Design targeted experiments to test hypotheses generated from integrated analysis

    • Verify key interactions using protein-protein interaction assays

    • Validate regulatory relationships through genetic perturbation

    • Confirm substrate relationships through degradation assays

When integrating data for At1g56610 specifically, pay attention to phosphorylation dynamics under osmotic stress conditions and temperature variations, building on previous research approaches in Arabidopsis , and connect these to potential SCF complex formation and substrate targeting.

What emerging technologies could advance our understanding of At1g56610 function?

Several cutting-edge technologies show promise for elucidating At1g56610 function:

  • Advanced protein structure determination:

    • AlphaFold2 and RoseTTAFold: Apply AI-based structure prediction to model At1g56610 alone and in complex with SCF components

    • Cryo-EM: Determine structures of entire SCF complexes containing At1g56610

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Map conformational changes upon substrate binding or phosphorylation

    • Single-molecule FRET: Study dynamic conformational changes in real-time

  • Next-generation genome editing:

    • Prime editing: Create precise modifications at the At1g56610 locus without double-strand breaks

    • Base editing: Introduce specific point mutations to test phosphorylation site function

    • CRISPR activation/interference: Modulate At1g56610 expression without genetic modification

    • Multiplexed CRISPR screens: Systematically test genetic interactions with At1g56610

  • Advanced proteomics approaches:

    • Proximity-dependent labeling: Apply TurboID or APEX2 fusions to identify transient interactors

    • Cross-linking mass spectrometry (XL-MS): Map protein interaction surfaces

    • Targeted proteomics: Develop parallel reaction monitoring assays for At1g56610 and interactors

    • Ubiquitin remnant profiling: Identify substrates by tracking ubiquitinated residues

  • Single-cell and spatial technologies:

    • Single-cell RNA-seq: Profile transcriptional consequences of At1g56610 activity at cellular resolution

    • Spatial transcriptomics: Map expression patterns in tissue context

    • Light-sheet microscopy: Track At1g56610 dynamics in living tissues

    • Protein correlation profiling: Map protein complex dynamics across subcellular compartments

  • Systems and synthetic biology approaches:

    • Optogenetic control: Engineer light-controlled versions of At1g56610 for temporal regulation

    • Synthetic circuits: Reconstruct At1g56610 regulatory networks in heterologous systems

    • Metabolic flux analysis: Connect At1g56610 function to physiological outputs

    • Multi-scale modeling: Integrate molecular, cellular, and organismal-level data

Similar to approaches used for glycoengineering recombinant proteins and methodologies employed for molecular characterization in Arabidopsis , these technologies could provide comprehensive insights into At1g56610 function, particularly how its phosphorylation status affects its roles in plant stress responses and development.

How might understanding At1g56610 function contribute to improving crop stress tolerance?

Understanding At1g56610 function could significantly impact crop improvement strategies through several translational pathways:

  • Comparative genomics and crop engineering:

    • Identify At1g56610 orthologs in major crops using phylogenomic approaches

    • Determine conservation of phosphorylation sites and regulatory mechanisms

    • Engineer crop orthologs using CRISPR-based genome editing

    • Create phosphorylation site variants to modulate protein function

  • Stress response optimization:

    • Characterize how At1g56610 contributes to osmotic stress responses in Arabidopsis

    • Determine if modulating ortholog expression or phosphorylation affects drought tolerance

    • Engineer stress-inducible expression systems for precisely timed activation

    • Stack At1g56610-based modifications with other stress tolerance traits

  • Targeted breeding applications:

    • Develop molecular markers around orthologous loci for marker-assisted selection

    • Screen germplasm collections for natural variation in ortholog function

    • Identify superior alleles from wild relatives for introgression

    • Use genomic selection approaches incorporating functional data

  • Field validation and performance testing:

    • Design field trials to assess stress tolerance under realistic conditions

    • Measure physiological parameters across stress gradients

    • Analyze yield components and stability across environments

    • Evaluate potential trade-offs between stress tolerance and productivity

  • Integration with broader crop improvement strategies:

    • Combine protein engineering approaches with traditional breeding

    • Develop multi-trait improvement strategies addressing multiple stresses

    • Consider tissue-specific or developmental stage-specific interventions

    • Assess sustainability metrics and environmental impacts of engineered varieties

The transition from fundamental knowledge to applications should build on insights from temperature response studies and osmotic stress experiments in Arabidopsis , while also implementing recombinant protein production methodologies for functional verification in heterologous systems before crop implementation.

What are the most reliable databases and tools for studying At1g56610?

For comprehensive analysis of At1g56610, researchers should utilize these specialized resources:

  • Primary sequence and annotation databases:

    • TAIR (The Arabidopsis Information Resource): Provides curated gene models, functional annotations, and expression data specific to At1g56610

    • UniProt: Contains protein sequence, domain information, and curated functional data

    • Ensembl Plants: Offers genomic context, conservation, and variant information

    • 1001 Genomes Project: Provides natural variation data across Arabidopsis ecotypes

  • Expression and co-expression resources:

    • Arabidopsis eFP Browser: Visualizes tissue-specific and condition-specific expression patterns

    • ATTED-II: Identifies co-expressed genes and potential functional associations

    • Genevestigator: Allows meta-analysis of expression across multiple experiments

    • TraVA (Transcriptome Variation Analysis): Explores expression variation across conditions

  • Protein interaction databases:

    • BioGRID: Curates protein-protein interactions from various experimental approaches

    • STRING: Provides predicted and known protein interactions

    • IntAct: Offers molecular interaction data with detailed experimental evidence

    • Arabidopsis Interactome: Contains systematically mapped protein interactions

  • Structural prediction tools:

    • AlphaFold DB: Provides predicted structures for Arabidopsis proteins

    • SWISS-MODEL: Enables homology modeling based on related structures

    • I-TASSER: Offers integrated structure prediction

    • MolProbity: Allows assessment of model quality

  • Specialized F-box protein resources:

    • PlantsUFO: Database dedicated to F-box proteins in plants

    • F-box protein family pages in TAIR: Collates family-specific information

    • Ubiquitination site prediction tools: Identifies potential substrate modification sites

    • PhosphAt: Database of plant protein phosphorylation sites with specific data for Arabidopsis

When analyzing phosphorylation data, researchers should integrate information from phosphoproteomic studies that have identified the VFS(ph)QATLVTLK site and consider methodological approaches used in previous Arabidopsis studies examining protein modifications under stress conditions.

What experimental protocols are recommended for characterizing novel F-box protein functions?

For comprehensive characterization of novel F-box proteins like At1g56610:

Standardized Protocol Collection:

  • Biochemical characterization:

    • SCF complex reconstitution protocol:

      • Express and purify recombinant components (At1g56610, ASK1, CUL1, RBX1)

      • Verify complex formation through size exclusion chromatography

      • Confirm E3 ligase activity using in vitro ubiquitination assays

      • Test substrate specificity with candidate proteins

    • Phosphorylation analysis protocol:

      • Develop a targeted mass spectrometry assay for the VFS(ph)QATLVTLK phosphopeptide

      • Quantify phosphorylation status under different conditions

      • Perform in vitro kinase assays to identify responsible kinases

      • Create phospho-specific antibodies for routine detection

  • Cellular localization and dynamics:

    • Subcellular localization protocol:

      • Generate fluorescent protein fusions preserving F-box functionality

      • Examine localization in stable transgenic lines and transient expression

      • Perform co-localization with organelle markers

      • Analyze dynamics during stress responses and cell cycle progression

    • Protein turnover analysis protocol:

      • Measure protein half-life using cycloheximide chase assays

      • Determine ubiquitination status using immunoprecipitation

      • Assess proteasome-dependence using MG132 treatment

      • Compare turnover of wild-type and phospho-variants

  • Genetic and phenotypic analysis:

    • CRISPR/Cas9 mutagenesis and phenotyping protocol:

      • Generate knockout and phospho-site mutants

      • Characterize growth under normal and stress conditions

      • Examine root architecture and hypocotyl elongation phenotypes

      • Test responses to various hormones and stresses

    • Transcriptome analysis protocol:

      • Compare wild-type and mutant transcriptomes under relevant conditions

      • Identify differentially expressed genes and enriched pathways

      • Validate key targets using RT-qPCR

      • Correlate transcriptional changes with protein abundance

  • Substrate identification protocol:

    • Combine proximity labeling, co-immunoprecipitation, and differential proteomics

    • Validate candidates through direct interaction and ubiquitination assays

    • Perform genetic epistasis tests between F-box mutants and substrate mutants

    • Analyze substrate stability in F-box mutant backgrounds

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.