Recombinant Arabidopsis thaliana Fatty acid amide hydrolase (FAAH)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes; we will fulfill your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a useful reference for your own preparations.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag, please inform us, and we will prioritize its inclusion.
Synonyms
FAAH; At5g64440; T12B11.3; Fatty acid amide hydrolase; AtFAAH; N-acylethanolamine amidohydrolase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-607
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
FAAH
Target Protein Sequence
MGKYQVMKRASEVDLSTVKYKAETMKAPHLTGLSFKLFVNLLEAPLIGSLIVDYLKKDNG MTKIFRNTVIPEEPMFRPEFPSQEPEHDVVIVGEDESPIDRLETALKCLPQYDPSRSLHA DPVSSFRYWKIRDYAYAYRSKLTTPLQVAKRIISIIEEFGYDKPPTPFLIRFDANEVIKQ AEASTRRFEQGNPISVLDGIFVTIKDDIDCLPHPTNGGTTWLHEDRSVEKDSAVVSKLRS CGAILLGKANMHELGMGTTGNNSNYGTTRNPHDPKRYTGGSSSGSAAIVAAGLCSAALGT DGGGSVRIPSALCGITGLKTTYGRTDMTGSLCEGGTVEIIGPLASSLEDAFLVYAAILGS SSADRYNLKPSPPCFPKLLSHNGSNAIGSLRLGKYTKWFNDVSSSDISDKCEDILKLLSN NHGCKVVEIVVPELEEMRAAHVISIGSPTLSSLTPYCEAGKNSKLSYDTRTSFAIFRSFS ASDYIAAQCLRRRLMEYHLNIFKDVDVIVTPTTGMTAPVIPPDALKNGETNIQVTTDLMR FVLAANLLGFPAISVPVGYDKEGLPIGLQIMGRPWAEATVLGLAAAVEELAPVTKKPAIF YDILNTN
Uniprot No.

Target Background

Function

This recombinant Arabidopsis thaliana Fatty Acid Amide Hydrolase (FAAH) catalyzes the hydrolysis of bioactive endogenous fatty acid amides into their corresponding acids. This hydrolysis terminates their function as lipid mediators in various signaling pathways. The enzyme exhibits broad substrate specificity, converting a range of N-acylethanolamines (NAEs) to free fatty acids and ethanolamine. While it effectively utilizes oleamide as a substrate, it does not process indole-3-acetamide, 1-naphthaleneacetamide, nicotinic acid amide, or L-asparagine. It also processes 2-arachidonylglycerol. FAAH plays a significant role in plant growth regulation, hydrolyzing N-dodecanoylethanolamine, a compound that inhibits seedling growth. Furthermore, it participates in plant defense signaling and abscisic acid (ABA) signaling, though the latter mechanism is independent of its catalytic activity. Its involvement in flowering time regulation and the hydrolysis of N-acyl L-homoserine lactones (AHLs) – bacterial quorum sensing molecules – has also been established. The accumulation of L-homoserine appears to promote plant growth at low concentrations by stimulating transpiration, but higher concentrations inhibit growth by stimulating ethylene production.

Gene References Into Functions
  1. This study demonstrates the feasibility of employing an unbiased chemical genetic approach to identify novel pharmacological tools for manipulating FAAH- and NAE-mediated physiological processes in plants. PMID: 28112243
  2. AtFAAH is a key modulator of endogenous N-Acylethanolamine (NAE) levels in plants, although not the sole regulator, and NAE depletion likely contributes to the regulation of plant growth. PMID: 16880402
  3. AtFAAH overexpression inhibits innate immunity against Pseudomonas syringae in Arabidopsis, resulting in reduced levels of jasmonic acid, abscisic acid, and salicylic acid. PMID: 18643971
  4. AtFAAH influences plant growth and interacts with ABA signaling and plant defense through distinct mechanisms. PMID: 19801664
Database Links

KEGG: ath:AT5G64440

STRING: 3702.AT5G64440.1

UniGene: At.19619

Protein Families
Amidase family
Subcellular Location
Endoplasmic reticulum membrane. Cell membrane.
Tissue Specificity
Expressed in roots, leaves and flowers. Expressed in seedlings, flowers, roots, siliques, seeds and leaves.

Q&A

What is Arabidopsis thaliana Fatty Acid Amide Hydrolase (AtFAAH) and how is it identified?

AtFAAH is a plant enzyme encoded by the locus At5g64440 that functions as a homologue of mammalian FAAH. It consists of 607 amino acids with 37% identity to rat FAAH within the amidase signature (AS) domain . The enzyme contains a single transmembrane domain near the N-terminus, similar to its mammalian counterpart . AtFAAH was identified through bioinformatic approaches that revealed functional homologues across diverse plant species, including rice (Oryza sativa) and barrel clover (Medicago truncatula) . The identification of AtFAAH provided the first molecular evidence for NAE-metabolizing enzymes in plants, establishing a parallel to the endocannabinoid signaling pathway in animals.

To study AtFAAH, researchers typically use a combination of molecular genetics approaches, including T-DNA insertional mutagenesis (SALK_095108 and SALK_118043 lines have insertions in the 13th intron and 17th exon, respectively) and overexpression using the CaMV 35S promoter . Expression analysis through semiquantitative RT-PCR confirms the absence of AtFAAH transcripts in knockout lines and elevated expression in overexpressors .

How is recombinant AtFAAH expressed for research applications?

Methodology for recombinant AtFAAH expression:

  • Heterologous expression in Escherichia coli is the primary method for producing recombinant AtFAAH protein for in vitro studies .

  • The full-length cDNA is cloned into an appropriate expression vector with an affinity tag for purification.

  • Expression conditions are optimized for temperature, IPTG concentration, and induction time to maximize soluble protein yield.

  • Purification is typically performed using affinity chromatography.

  • The purified recombinant protein is functionally validated through enzymatic assays measuring the hydrolysis of various NAE substrates to their corresponding free fatty acids and ethanolamine .

Recombinant AtFAAH expressed in E. coli has been confirmed to hydrolyze a wide range of naturally occurring fatty acid amides, establishing its functional similarity to mammalian FAAH . This expression system has proven particularly valuable for structure-function studies, including site-directed mutagenesis experiments targeting conserved catalytic residues.

What are the key catalytic residues in AtFAAH and how do they compare to mammalian FAAH?

Five amino acids critical for catalytic activity in rat FAAH are conserved in AtFAAH:

Conserved ResiduePosition in AtFAAHFunction
LysineLys-205Part of catalytic triad
SerineSer-281Part of catalytic triad
SerineSer-282Substrate binding
SerineSer-305Part of catalytic triad
ArginineArg-307Substrate binding

Site-directed mutation of each of these conserved residues abolished the hydrolytic activity of AtFAAH when expressed in E. coli . Homology modeling of the amidase signature region of plant FAAH revealed a highly conserved active site organization with the catalytic triad positioned in the substrate-binding site . This structural conservation suggests a common catalytic mechanism between plant and animal FAAH enzymes, despite their evolutionary distance.

What phenotypes are observed in plants with altered AtFAAH expression?

Comparative phenotypic analysis of AtFAAH-modified plants:

PhenotypeAtFAAH OverexpressorsAtFAAH Knockouts
Seedling growthEnhanced growth, increased cell/organ sizeNormal under standard conditions
NAE sensitivityTolerant to exogenous NAEsHypersensitive to exogenous NAEs
Seed NAE content20-50% reduction~30% increase
ABA sensitivityHypersensitiveNormal
Pathogen susceptibilityHypersusceptible to nonhost pathogensNormal
Germination timingEarlierNormal

AtFAAH overexpressors display enhanced seedling growth and increased cell/organ size, while being less sensitive to the growth-inhibitory effects of exogenous NAEs . Their seeds contain lower levels of endogenous NAEs . Interestingly, these plants are also hypersensitive to abscisic acid (ABA) and more susceptible to nonhost pathogens .

How does AtFAAH activity change during seed germination and seedling development?

AtFAAH expression and catalytic activity increase during seed germination and seedling growth, coinciding with the depletion of NAEs during seedling establishment . This temporal pattern suggests that AtFAAH-mediated NAE hydrolysis is developmentally regulated and may be an important mechanism for reducing NAE levels that would otherwise inhibit seedling growth.

The correlation between increased AtFAAH activity and NAE depletion supports the hypothesis that NAEs function as negative regulators of seedling growth . As seeds transition from dormancy to active growth, the upregulation of AtFAAH likely contributes to the removal of growth-inhibitory NAEs, thereby facilitating normal seedling development. This pattern is consistent across various plant species, suggesting a conserved role for FAAH in early plant development.

What is the substrate specificity of AtFAAH?

Recombinant AtFAAH can hydrolyze a variety of naturally occurring fatty acid amides . While the enzyme shows activity toward multiple NAE species, its efficiency may vary depending on the acyl chain length and degree of unsaturation. In addition to NAEs, FAAH has been shown to hydrolyze other lipid substrates in vitro, including:

  • Monoacylglycerols

  • Fatty acid primary amides

  • Various NAE species with different acyl chains (saturated and unsaturated)

The ability of AtFAAH to metabolize multiple substrates suggests it may have broader physiological roles beyond NAE hydrolysis. This substrate promiscuity is similar to that observed in mammalian FAAH, further supporting functional conservation between plant and animal systems.

What are the dual functions of AtFAAH in plant physiology?

AtFAAH exhibits dual functionality in plant physiology:

  • Catalytic-dependent function: Influences plant growth through its amidase activity toward NAEs. Overexpression of AtFAAH leads to enhanced seedling growth and tolerance to exogenous NAEs, while knockout of AtFAAH results in hypersensitivity to NAEs .

  • Catalytic-independent function: Interacts with plant defense and ABA signaling through mechanisms independent of its enzymatic activity. Site-directed mutants lacking catalytic activity still confer hypersensitivity to ABA and hypersusceptibility to nonhost pathogens when overexpressed .

This dual functionality was elegantly demonstrated through experiments with catalytically inactive AtFAAH variants. When these variants were overexpressed in Arabidopsis, they failed to enhance growth or confer NAE tolerance (catalytic-dependent functions) but still produced the ABA hypersensitivity and pathogen susceptibility phenotypes (catalytic-independent functions) . This suggests AtFAAH may serve as a bifunctional protein with separate domains for enzymatic activity and protein-protein interactions in signaling pathways.

How do site-directed mutations affect AtFAAH activity and plant phenotypes?

Site-directed mutagenesis experiments targeting the conserved catalytic residues (Lys-205, Ser-281, Ser-282, Ser-305, and Arg-307) have provided valuable insights into AtFAAH function:

  • Mutation of any of these residues abolishes the hydrolytic activity of recombinant AtFAAH when expressed in E. coli .

  • Plants overexpressing these inactive AtFAAH mutants show no growth enhancement and no tolerance to exogenous NAEs, confirming these phenotypes depend on catalytic activity .

  • Surprisingly, plants overexpressing inactive AtFAAH mutants remain hypersensitive to ABA and hypersusceptible to nonhost pathogens, demonstrating these responses are independent of enzymatic activity .

These findings suggest that AtFAAH's protein structure, rather than its catalytic activity, mediates certain signaling interactions. The ability to separate catalytic-dependent and catalytic-independent functions through specific mutations provides a powerful tool for dissecting the complex roles of AtFAAH in plant physiology.

What is the relationship between AtFAAH, LOX enzymes, and NAE-oxylipins in regulating plant growth?

AtFAAH and lipoxygenase (LOX) enzymes compete for polyunsaturated NAE substrates, particularly NAE18:2, creating a complex regulatory network:

  • NAE18:2 can be hydrolyzed by AtFAAH to free fatty acid and ethanolamine, or oxygenated by 9-LOX or 13-LOX to form NAE-oxylipins .

  • The 9-LOX product of NAE18:2 (9-NAE-HOD) functions as a potent inhibitor of seedling growth and is involved in seedling growth arrest associated with secondary dormancy .

  • Arabidopsis faah-knockouts supplemented with NAE18:2 accumulate higher levels of 9-NAE-HOD and 13-NAE-HOD compared to wild-type plants .

  • AtFAAH overexpressors have barely detectable levels of these NAE-oxylipins when treated with NAE18:2 .

  • AtFAAH overexpressors show tolerance to exogenous 9-NAE-HOD, while 9-LOX-impaired mutants are more sensitive .

This competitive relationship between FAAH and LOX creates a metabolic balance that fine-tunes NAE-oxylipin levels, particularly 9-NAE-HOD, which modulates seedling growth in an ABA-dependent manner . The interplay between these enzyme systems represents a sophisticated regulatory mechanism controlling the transition from seed dormancy to active growth.

How do FAAH homologues in other plant species compare to AtFAAH?

Functional FAAH homologues have been identified in diverse plant species, suggesting conservation of NAE metabolism across the plant kingdom:

Plant SpeciesFAAH HomologuesRelationship to AtFAAHExpression Pattern
Cotton (Gossypium hirsutum)GhFAAH Ia, Ib, Ic (Group I)Cluster with AtFAAHHigher expression in tissues
Cotton (Gossypium hirsutum)GhFAAH IIa, IIb, IIc (Group II)More divergentLower expression
Rice (Oryza sativa)OsFAAHFunctional homologueSimilar to AtFAAH
Barrel clover (Medicago truncatula)MtFAAHFunctional homologueSimilar to AtFAAH

In cotton, Group I FAAHs (GhFAAH Ia, Ib, Ic) cluster phylogenetically with AtFAAH and show higher expression levels in various tissues compared to Group II FAAHs . Both groups can cooperate to regulate NAE levels, particularly unsaturated 18-carbon NAE species . Transgenic cotton seedlings with ectopic expression of AtFAAH exhibit tolerance to exogenously applied NAEs, similar to AtFAAH-overexpressing Arabidopsis .

These findings support a common mechanism for the regulation of NAE hydrolysis across diverse plant species , suggesting that FAAH-mediated NAE metabolism represents an evolutionarily conserved pathway in plants with important roles in growth and development.

What experimental approaches are used to measure AtFAAH activity in plant tissues?

Several methodological approaches are used to measure AtFAAH activity:

  • Radiolabeled substrate assays: Using 14C-labeled NAEs to track the formation of free fatty acids and ethanolamine. This approach has been utilized in both in vitro assays with recombinant protein and in plant tissue homogenates .

  • HPLC/MS-based methods: Liquid chromatography coupled with mass spectrometry to quantify the disappearance of NAE substrates and appearance of free fatty acid products. This approach offers higher sensitivity and specificity for analyzing multiple NAE species simultaneously.

  • Fluorescent substrate assays: Using synthetic fluorescent NAE analogs that release a fluorophore upon hydrolysis, allowing for real-time monitoring of enzyme activity.

  • In vivo metabolic labeling: Radiolabeling approaches in imbibed seeds to track the metabolism of NAEs during germination .

  • Activity-based protein profiling: Using activity-based probes that bind to the active site of FAAH enzymes, allowing visualization and quantification of active enzyme.

When measuring AtFAAH activity in plant tissues, it's essential to include appropriate controls, such as heat-inactivated samples and specific inhibitors, to distinguish FAAH activity from other amidases or lipases that might be present in the tissue.

How can recombinant AtFAAH be used to study NAE signaling pathways in plants?

Recombinant AtFAAH serves as a valuable tool for investigating NAE signaling pathways through several approaches:

  • Substrate specificity studies: Using purified recombinant AtFAAH to determine the relative efficiency of different NAE substrates can reveal which NAE species might be physiologically relevant in plants.

  • Inhibitor development and screening: Testing various compounds for their ability to inhibit recombinant AtFAAH activity can lead to the development of specific inhibitors for use in physiological studies.

  • Protein-protein interaction studies: Using recombinant AtFAAH to identify interacting proteins through pull-down assays, yeast two-hybrid screening, or co-immunoprecipitation can reveal potential signaling partners.

  • Structural studies: X-ray crystallography or cryo-EM of recombinant AtFAAH, alone or in complex with substrates or inhibitors, can provide insights into the enzyme's mechanism and specificity.

These approaches can help elucidate the molecular mechanisms by which AtFAAH regulates NAE levels and influences downstream signaling events in plant growth, development, and stress responses.

What are the implications of AtFAAH's dual functionality for engineering stress-resistant plants?

The discovery that AtFAAH has both catalytic-dependent and catalytic-independent functions opens new possibilities for plant engineering:

  • Targeted modulation of specific functions: By introducing specific mutations that affect either the catalytic activity or the signaling function of AtFAAH, it may be possible to selectively enhance certain traits without unwanted side effects.

  • Enhanced growth without compromised defense: While overexpression of wild-type AtFAAH enhances growth but increases susceptibility to pathogens, engineering variants that maintain catalytic activity but lack the defense-suppressing function could potentially provide growth benefits without compromising immunity.

  • Stress-responsive expression systems: Placing AtFAAH under the control of stress-responsive promoters could allow for dynamic regulation of NAE levels in response to environmental challenges.

  • Cross-species applications: The conservation of FAAH function across plant species suggests that knowledge gained from Arabidopsis could be applied to crop improvement programs targeting yield enhancement or stress tolerance.

Understanding the molecular basis of AtFAAH's dual functionality will be crucial for these applications, requiring further research into the protein domains responsible for each function and their interactions with other cellular components.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.