Recombinant Arabidopsis thaliana Flavin-containing monooxygenase FMO GS-OX3 (FMOGS-OX3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Arabidopsis thaliana Flavin-containing Monooxygenase FMO GS-OX3 (FMOGS-OX3)

Recombinant Arabidopsis thaliana Flavin-containing Monooxygenase FMO GS-OX3 (FMOGS-OX3) is a protein enzyme derived from the model plant Arabidopsis thaliana. This enzyme belongs to the family of flavin-containing monooxygenases, which are involved in various metabolic processes, including the biosynthesis of glucosinolates. Glucosinolates are secondary metabolites found in cruciferous plants and play significant roles in defense mechanisms against pathogens and pests.

Characteristics of FMOGS-OX3

  • Protein Structure and Expression: FMOGS-OX3 is a full-length protein consisting of 462 amino acids. It is expressed in Escherichia coli and is available as a recombinant protein with an N-terminal His tag, facilitating purification and identification .

  • Function: While specific functions of FMOGS-OX3 are less detailed compared to other flavin-monooxygenases like FMO GS-OX1, these enzymes generally catalyze the S-oxygenation of glucosinolate side chains, which is crucial for their biological activity .

  • Storage and Handling: The recombinant protein is provided as a lyophilized powder and should be stored at -20°C or -80°C. Reconstitution is recommended in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of glycerol for long-term storage .

Research Findings and Applications

  • Glucosinolate Biosynthesis: Flavin-monooxygenases, including FMOGS-OX3, are involved in the biosynthesis of glucosinolates by modifying their side chains. This process is essential for the diverse biological activities of glucosinolates, including defense against pathogens and pests .

  • Genetic Mapping: Studies have identified a subclade of flavin-monooxygenases in Arabidopsis, including FMO GS-OX1, FMO GS-OX2, FMO GS-OX3, and others, which are crucial for glucosinolate metabolism. These enzymes are mapped to specific genomic regions and are associated with quantitative trait loci (QTLs) related to glucosinolate S-oxygenation .

References

  1. Science.org: Trimethylamine N-oxide is a new plant molecule that promotes...

  2. Creative Biomart: Recombinant Full Length Arabidopsis Thaliana Flavin-Containing Monooxygenase FMO GS-OX3 (FMOGS-OX3) Protein, His-Tagged

  3. UniProt: FMOGS-OX3 - Arabidopsis thaliana (Mouse-ear cress)

  4. PMC: Subclade of Flavin-Monooxygenases Involved in Aliphatic...

  5. Nature: Transcriptomic and metabolic analyses revealed the modulatory...

  6. Frontiers in Plant Science: Two Novel Flavin-Containing Monooxygenases Involved...

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
FMOGS-OX3; At1g62560; T3P18.12; Flavin-containing monooxygenase FMO GS-OX3; Flavin-monooxygenase glucosinolate S-oxygenase 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-462
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
FMOGS-OX3
Target Protein Sequence
MAPAQNQITSKHVAVIGAGPAGLITSRELRREGHSVVVFEREKQVGGLWVYTPKSDSDPL SLDPTRSKVHSSIYESLRTNVPRESMGVRDFPFLPRFDDESRDARRYPNHREVLAYIQDF AREFKIEEMIRFETEVVRVEPVDNGNWRVQSKNSGGFLEDEIYDAVVVCNGHYTEPNIAH IPGIKSWPGKQIHSHNYRVPDPFENEVVVVIGNFASGADISRDIAKVAKEVHIASRAREP HTYEKISVPQNNLWMHSEIDTTHEDGSIVFKNGKVIFADSIVYCTGYKYNFPFLETNGYL RIDEKRVEPLYKHVFPPALAPGLAFVGLPAMGIVFVMFEIQSKWVAAVLSGRVTLPSTDK MMEDINAWYASLDALGIPKRHTHTIGRIQSEYLNWVAKESGCELVERWRGQEVDGGYLRL VAHPETYRDEWDDDELIEEAYNDFSRKKLISVDPSYYLENGR
Uniprot No.

Target Background

Function

Function: Catalyzes the conversion of methylthioalkyl glucosinolates of any chain length into methylsulfinylalkyl glucosinolates. Shows a preference for short-chain methylthioalkyl glucosinolates in the Arabidopsis thaliana cv. Landsberg erecta.

Database Links

KEGG: ath:AT1G62560

STRING: 3702.AT1G62560.1

UniGene: At.16349

Protein Families
FMO family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is FMO GS-OX3 and how is it functionally classified among plant FMOs?

FMO GS-OX3 (At1g62570) is a member of the crucifer-specific subclade of flavin-containing monooxygenases in Arabidopsis thaliana. It belongs to a group of enzymes that catalyze the S-oxygenation of methylthioalkyl glucosinolates (MT-GSLs) to methylsulfinylalkyl glucosinolates (MS-GSLs) . Phylogenetic analysis places FMO GS-OX3 in what appears to be a crucifer-specific clade III of the FMO superfamily, which has diverged from FMO clades found in other plant species .

Within the Arabidopsis genome, five related members of this FMO subfamily (FMO GS-OX1 to FMO GS-OX5) have been identified, with FMO GS-OX3 specifically mapping to chromosome 1 and showing tandem duplication with FMO GS-OX2 (At1g62560) . This enzyme subfamily represents specialized metabolic functions that appear to have evolved specifically in cruciferous plants, correlating with their unique glucosinolate chemistry .

What is the biochemical function of FMO GS-OX3 in glucosinolate metabolism?

FMO GS-OX3 primarily functions as an S-oxygenating enzyme that catalyzes the conversion of methylthioalkyl glucosinolates to methylsulfinylalkyl glucosinolates in the aliphatic glucosinolate biosynthetic pathway . This reaction represents the final phase in aliphatic glucosinolate biosynthesis, following methionine chain elongation and glucosinolate core structure formation .

The S-oxygenation reaction catalyzed by FMO GS-OX3 can be represented as:

R-S-CH₃ (methylthioalkyl-GSL) + O₂ + NADPH + H⁺ → R-SO-CH₃ (methylsulfinylalkyl-GSL) + H₂O + NADP⁺

Where R represents the variable alkyl side chain of the glucosinolate molecule. This enzymatic transformation is crucial for generating the bioactive forms of glucosinolates that serve defensive functions in plants .

How does FMO GS-OX3 relate structurally and functionally to other FMO GS-OX family members?

FMO GS-OX3 shares significant sequence homology with other members of the FMO GS-OX family, particularly with FMO GS-OX2 and FMO GS-OX1, with which it forms a tandem gene cluster on chromosome 1 . Phylogenetic analysis reveals that these enzymes form a distinct subclade within the plant FMO superfamily:

Table 1: Arabidopsis FMO GS-OX family members and their genomic locations

EnzymeGene IDChromosome LocationKnown Function
FMO GS-OX1At1g65860Chr 1S-oxygenation of MT-GSLs
FMO GS-OX2At1g62560Chr 1S-oxygenation of MT-GSLs
FMO GS-OX3At1g62570Chr 1S-oxygenation of MT-GSLs
FMO GS-OX4At1g12140Chr 1S-oxygenation of MT-GSLs
FMO GS-OX5At1g12130Chr 1S-oxygenation of MT-GSLs

While these enzymes catalyze the same basic reaction, they exhibit differences in substrate specificity, expression patterns, and possibly regulatory mechanisms . Studies with knockout mutants have demonstrated functional redundancy among these enzymes, as the presence of methylsulfinylalkyl glucosinolates in FMO GS-OX1 T-DNA knockout mutants indicated that additional genes with similar function exist in the genome .

What experimental approaches have been most effective for investigating FMO GS-OX3 function?

Investigating FMO GS-OX3 function has relied on multiple complementary experimental approaches:

Genetic Mapping and QTL Analysis

Fine mapping of quantitative trait loci (QTLs) for S-oxygenating activity has been instrumental in identifying FMO GS-OX3 and related genes. This approach identified a 0.2-Mb region containing FMO GS-OX3 along with FMO GS-OX1 and FMO GS-OX2 . Researchers utilized natural variation in Arabidopsis accessions to isolate the genetic factors controlling the conversion of methylthioalkyl to methylsulfinylalkyl glucosinolates .

Knockout Mutant Analysis

T-DNA insertion mutants and gene knockouts have been essential for determining the in vivo function of FMO GS-OX3. Analysis of metabolite profiles in these mutants reveals changes in glucosinolate composition, particularly the ratio of methylthioalkyl to methylsulfinylalkyl glucosinolates .

Expression Analysis

RNA sequencing and microarray analysis have been employed to investigate the transcriptional regulation of FMO GS-OX3 under various conditions . These approaches have revealed that FMO GS-OX3 expression is modulated in response to stress factors, particularly salt stress and insect herbivory .

Recombinant Protein Expression and Enzyme Assays

For biochemical characterization, recombinant FMO GS-OX3 can be expressed in heterologous systems such as E. coli, purified, and assayed for enzymatic activity using methylthioalkyl glucosinolate substrates. Activity assays typically monitor the consumption of NADPH (measured spectrophotometrically at 340 nm) or the conversion of substrate to product (analyzed by HPLC or LC-MS) .

How does salt stress affect FMO GS-OX3 function and what alternative catalytic activities have been observed?

Under salt stress conditions, FMO GS-OX3 exhibits remarkable functional plasticity:

Salt stress induces an alternative catalytic activity in FMO GS-OX enzymes, including FMO GS-OX3, wherein they catalyze the formation of trimethylamine N-oxide (TMAO) from trimethylamine . This alternative activity represents a functional adaptation that contributes to salt tolerance mechanisms in Arabidopsis.

The shift in enzymatic activity is accompanied by changes in gene expression patterns. Salt stress induces the expression of myrosinase genes, which leads to the degradation of methylsulfinylalkyl glucosinolates (MS-GSLs) . This degradation relieves the promotion of flowering regulator WRKY75 and the inhibition of MAF4, leading to delayed flowering—a beneficial adaptation under stress conditions .

The degradation products derived from MS-GSLs enhance salt tolerance through multiple mechanisms. Additionally, the TMAO produced by the alternative activity of FMO GS-OX3 activates multiple stress-related genes, providing another layer of protection against salt stress .

This dual functionality of FMO GS-OX3 represents a sophisticated integration of flowering transition and stress tolerance mechanisms in Arabidopsis, highlighting how metabolic enzymes can serve multiple roles depending on environmental conditions .

What is known about the transcriptional regulation of FMO GS-OX3?

The transcriptional regulation of FMO GS-OX3 involves multiple layers of control:

Transcription Factor Networks

FMO GS-OX3 expression is regulated by a complex interplay of transcription factors, with R2R3 MYB transcription factors playing a particularly important role. Three related members of the R2R3 MYB transcription factor family (MYB28, MYB29, and MYB76) regulate aliphatic glucosinolate biosynthesis genes, including FMO GS-OX3 .

Expression QTLs (eQTLs)

Genetic mapping studies have identified cis-expression QTLs for FMO GS-OX3, suggesting that gene expression variation rather than enzyme activity differences underlies natural variation in glucosinolate profiles . This indicates that regulatory polymorphisms in the promoter region of FMO GS-OX3 contribute significantly to phenotypic diversity in glucosinolate metabolism .

Stress-Responsive Regulation

FMO GS-OX3 shows differential expression in response to various biotic and abiotic stresses:

Table 2: Stress conditions affecting FMO GS-OX3 expression

Stress ConditionEffect on ExpressionDownstream ConsequencesReference
Salt stressInducedAlternative catalytic activity (TMAO production)
Insect herbivoryDifferential expressionEnhanced defense response
Mechanical woundingAltered expressionPart of local and systemic response

Transcriptome analyses have revealed that FMO GS-OX3 expression is significantly altered during insect herbivory, with different responses to generalist versus specialist herbivores . This suggests a role in defense specificity against different types of attackers.

How can recombinant FMO GS-OX3 be efficiently expressed and purified for structural and functional studies?

Efficient expression and purification of recombinant FMO GS-OX3 requires specialized approaches due to its membrane-associated nature and cofactor requirements:

Expression System Selection

Bacterial expression systems (E. coli) can be used with optimization for plant proteins. The pET expression system with BL21(DE3) strain is commonly employed, with growth at lower temperatures (16-20°C) after induction to enhance proper folding .

Construct Design

For optimal expression:

  • Include an N-terminal 6×His tag or GST tag for purification

  • Consider codon optimization for E. coli

  • Remove any predicted transmembrane domains or N-terminal targeting sequences

  • Include the FAD-binding domain intact

  • Clone the full-length coding sequence into an expression vector with an inducible promoter

Expression Conditions

Optimal conditions typically include:

  • Induction at OD₆₀₀ of 0.6-0.8 with 0.1-0.5 mM IPTG

  • Supplementation with riboflavin (10 μM) to enhance FAD cofactor availability

  • Expression at 18°C for 16-20 hours to promote proper folding

  • Growth in Terrific Broth (TB) medium for higher protein yields

Purification Protocol

A multi-step purification approach is recommended:

  • Cell lysis using sonication or French press in buffer containing protease inhibitors

  • Affinity chromatography using Ni-NTA or glutathione resin

  • Size exclusion chromatography to remove aggregates

  • Ion exchange chromatography for further purification

Buffer composition is critical and should include:

  • 50 mM Tris-HCl or phosphate buffer (pH 7.5-8.0)

  • 100-300 mM NaCl

  • 10% glycerol as stabilizer

  • 0.1 mM EDTA to prevent metal-catalyzed oxidation

  • 1 mM DTT or 2 mM β-mercaptoethanol to maintain reduced cysteines

  • Flavin cofactor (FAD or FMN, 10 μM)

The purified enzyme should be stored with glycerol (20-30%) at -80°C or in small aliquots at -20°C to maintain activity.

What is the relationship between FMO GS-OX3 activity and plant defense responses against herbivores and pathogens?

FMO GS-OX3 plays a multifaceted role in plant defense through its involvement in glucosinolate metabolism:

Insect Herbivory Defense

The S-oxygenation of methylthioalkyl glucosinolates to methylsulfinylalkyl glucosinolates by FMO GS-OX3 is crucial for generating bioactive defense compounds . Upon tissue damage, these compounds undergo myrosinase-catalyzed hydrolysis to form isothiocyanates and other toxic derivatives that deter herbivores .

Transcriptome analyses have shown that FMO GS-OX3 expression is regulated in response to insect feeding, with different patterns observed for generalist versus specialist herbivores . This suggests a role in tailoring defense responses to specific attackers.

Pathogen Resistance

While the primary role of FMO GS-OX3 is in glucosinolate metabolism, the broader FMO family in plants has been implicated in disease resistance . Some FMOs are crucial for systemic acquired resistance (SAR) against microbial pathogens, suggesting potential crossover functions .

Research indicates that certain members of the FMO family in cereal crops may be involved in responses against both biotrophic and necrotrophic pathogens, suggesting evolutionary conservation of defense functions despite the absence of glucosinolates in these species .

Integration with Stress Responses

FMO GS-OX3 functions at the intersection of biotic and abiotic stress responses:

Table 3: FMO GS-OX3 mediated defense mechanisms

Defense ContextMechanismOutcomeReference
Insect herbivoryProduction of methylsulfinylalkyl GSLsFormation of toxic isothiocyanates upon tissue damage
Salt stressAlternative catalytic activity (TMAO production)Enhanced stress tolerance and delayed flowering
Transcriptional responsesModulation by R2R3 MYB transcription factorsCoordinated defense metabolism

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.