Recombinant Arabidopsis thaliana Formin-like protein 3 (FH3)

Shipped with Ice Packs
In Stock

Description

The Formin Protein Family

Formins constitute a large, evolutionarily conserved family of proteins that function as actin-nucleating factors with additional roles in regulating microfilament, microtubule, and membrane dynamics . These multi-domain proteins are found across eukaryotic organisms and are particularly important in plants, where they contribute to various cellular processes requiring cytoskeletal organization. In angiosperms, formins form two evolutionarily distinct families—Class I and Class II—each exhibiting characteristic domain organization and functional specialization .

Classification of Arabidopsis Formins

The genome of Arabidopsis thaliana encodes 21 formin proteins that are classified into two distinct phylogenetic groups . Class I formins typically contain N-terminal transmembrane domains that enable them to anchor cytoskeletal structures to membranes, while many Class II formins feature N-terminal PTEN-like domains that facilitate membrane association . This classification reflects both structural similarities and functional divergence among plant formins. FH3 belongs to the Class I formin subfamily, which is particularly important for membrane-associated actin assembly in reproductive tissues .

Molecular Structure and Domain Organization

Arabidopsis thaliana Formin-like protein 3 (FH3) is a Class I formin characterized by a specific domain architecture that enables its specialized functions. Like other formins, FH3 contains conserved formin homology domains (FH domains) that are essential for its interactions with actin . These domains include the FH1 and FH2 domains, which are responsible for directing the assembly of unbranched actin filaments . The specific configuration of these domains in FH3 contributes to its specialized role in actin organization within pollen tubes.

Expression and Purification Systems

Recombinant Arabidopsis thaliana Formin-like protein 3 can be produced using prokaryotic expression systems. The commercially available recombinant protein is expressed in Escherichia coli with an N-terminal His-tag to facilitate purification . This expression system provides high yields of functional protein that can be used for various biochemical and functional studies. The recombinant protein corresponds to amino acids 21-785 of the native FH3 protein, representing the full functional length of the protein .

Role in Actin Cytoskeleton Organization

Arabidopsis thaliana FH3 plays a critical role in organizing the actin cytoskeleton, particularly in reproductive tissues. As a Class I formin, FH3 contributes to the organization of the actin fringe, a specialized actin structure in pollen tubes . This organization is essential for proper pollen tube growth and development. FH3 is responsible for the polymerization of membrane-originated actin cables at the pollen tube tip, which facilitates and maintains tip growth . The precise regulation of actin dynamics by FH3 ensures proper cell polarity and directional growth in pollen tubes.

Function in Pollen Tube Growth and Development

FH3 has been documented to nucleate actin on membrane vesicles during pollen germination, contributing significantly to tip growth initiation . The role of FH3 in pollen tube development is particularly important for plant reproduction, as proper pollen tube growth is essential for fertilization. Loss of FH3 function leads to defects in subapical actin structure that manifests as pollen tube thickening and abnormal tube growth patterns, characterized by wavy or kinky growth trajectories . These observations highlight the critical role of FH3 in maintaining the normal architecture of growing pollen tubes.

Loss-of-Function Studies

Research on FH3 function has employed various genetic approaches to understand its role in plant development. Downregulation of FH3 by RNA interference (RNAi) has been shown to inhibit pollen tube elongation, demonstrating the protein's essential role in this process . Additionally, loss of FH3 leads to defects in the subapical actin structure, resulting in abnormal pollen tube morphology characterized by thickening and irregular growth patterns . These findings confirm that FH3 is a critical component of the molecular machinery that regulates pollen tube growth and development in Arabidopsis thaliana.

Overexpression Studies

Complementary to loss-of-function studies, overexpression experiments have provided additional insights into FH3 function. Overexpression of a deletion derivative of FH3 in pollen leads to excessive actin cable formation and tip swelling, similar to the effects observed with overexpression of other Class I formins . These results suggest that the precise regulation of FH3 levels is critical for normal pollen tube development. The balance between different actin-regulating proteins, including formins like FH3, appears to be crucial for maintaining proper cell polarity and growth direction in pollen tubes.

Applications and Future Research Directions

Recombinant Arabidopsis thaliana Formin-like protein 3 serves as a valuable tool for various research applications. The availability of purified recombinant protein enables detailed biochemical studies of FH3 function, including its interactions with actin and other cytoskeletal components. Current applications include SDS-PAGE analysis and functional studies examining the protein's role in actin organization .

Future research directions may include more detailed structural studies of FH3, investigation of its interactions with other cellular components, and exploration of its potential roles in processes beyond pollen tube growth. Additionally, comparative studies with other plant formins could provide insights into the evolution and specialization of this protein family in plants. Understanding the molecular mechanisms by which FH3 contributes to actin organization and pollen tube growth may also inform broader questions about cell polarity, directional growth, and fertilization in plants.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing it if feasible.
Synonyms
FH3; At4g15200/At4g15190; Dl3645c/Dl3640c; FCAALL.218; Formin-like protein 3; AtFH3; AtFORMIN-3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-785
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
FH3
Target Protein Sequence
EEIFSRGGLNLLRFSVYGEDVAEQTWIHQNPRRKLISYPKKFSVSAPNLAFGPAPSFAPG PGPSFAPGPAPNPRSYDWLAPASSPNEPPAETPDESSPSPSEETPSVVAPSQSVPGPPRP PPQREKKDDILMKLIIAVASTAVLTFVFVALMFLCCFKRNCNNAVGSRDGPRDEGPLLRL STGSTENSPTVASTSRKMFSVASSKKRSFLSRVSLKRNGHEFSTAESSSAAGLPPLKLPP GRSAPPPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPPKGAAPKRQGNTSSGDASDV DSETGAPKTKLKPFFWDKMANPDQKMVWHEISAGSFQFNEEAMESLFGYNDGNKNKNGQK STDSSLRESPLQYIQIIDTRKAQNLSILLRALNVTTEEVVDAIKEGNELPVELLQTLLKM APTSEEELKLRLYSGDLHLLGPAERFLKILVDIPFAFKRIESLLFMISLQEEVSGLKEAL GTLEVACKKLRNSRLFLKLLEAVLKTGNRMNVGTFRGDAQAFKLDTLLKLSDVKGTDGKT TLLHFVVLEIIRSEGVRALRLQSRSFSSVKTDDSNADSSPQSVERYRSTGLQVVTGLTTE LEDVKRAAIIDADGLAATLANISGSLTNAREFLKTMDEESDFERALAGFIERADADFKWL KEEEERIMVLVKSSADYFHGKSAKNEGLRLFAIVRDFLIMLEKVCREVKETTKTTNHSGK KESEMTTSDSNQPSPDFRQRLFPAIAERRMDSSDDSDDEEDSSPS
Uniprot No.

Target Background

Function
This protein functions as an actin nucleation factor, directing the formation of actin cables and polarized growth in pollen tubes.
Database Links
Protein Families
Formin-like family, Class-I subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Arabidopsis thaliana Formin-like protein 3 (FH3) and what are its key functional domains?

AFH3 is a 785-amino acid polypeptide that functions as an actin nucleation factor in Arabidopsis. It contains several key functional domains:

  • Signal peptide (amino acids 1-20)

  • Transmembrane domain (amino acids 143-167) at the N-terminus

  • Formin Homology 1 (FH1) domain (amino acids 253-307) containing a polyproline-rich stretch that binds to profilin

  • Formin Homology 2 (FH2) domain (amino acids 321-736) responsible for actin binding and nucleation activities

AFH3 belongs to Group I formins, which are characterized by the presence of a transmembrane domain that distinguishes them from formins in other organisms . The protein plays a crucial role in pollen tube growth by facilitating the formation of longitudinal actin cables .

How does FH3 function in actin cytoskeleton regulation?

AFH3 functions as an actin nucleator that promotes the formation of unbranched actin filaments, particularly in pollen tubes. The protein:

  • Interacts with the barbed end of actin filaments through its FH2 domain

  • Exhibits actin nucleation activity in the presence of G-actin or G-actin-profilin complexes

  • Promotes the polymerization of membrane-originated actin cables at the pollen tube tip

  • Facilitates and maintains tip growth in pollen tubes

When overexpressed in tobacco pollen tubes, AFH3 induces excessive actin cables that extend into the tubes' apices, while specific downregulation eliminates actin cables in Arabidopsis pollen tubes . Unlike the Arp2/3 complex that generates branched actin networks, formins like AFH3 produce unbranched actin filaments, often organized into parallel cables .

What experimental approaches are most effective for studying FH3 expression patterns?

Researchers can employ multiple complementary approaches to study AFH3 expression:

  • RT-PCR Analysis: Semi-quantitative RT-PCR can determine tissue-specific expression patterns. For formins in the FHY3/FAR1 gene family, this technique revealed expression in rosette leaves, cauline leaves, inflorescence stems, flowers, and siliques .

  • Promoter-Reporter Fusion: Creating AFH3 promoter-GUS fusion constructs enables visualization of tissue-specific expression. This approach has been successful with related genes, showing expression in hypocotyls that is induced by far-red light treatment .

  • Protein Fusion Tagging: Developing transgenic plants expressing AFH3-YFP fusion proteins allows for in vivo localization studies. When creating such constructs, it's important to verify that the tag doesn't interfere with normal protein function, as demonstrated with FHY3-YFP fusions .

  • In situ Hybridization: This technique can provide cellular resolution of gene expression when antibodies for immunolocalization are unavailable.

What is the difference between Group I and Group II formins in Arabidopsis?

Arabidopsis formins are divided into two distinct classes based on their structural characteristics:

FeatureGroup I ForminsGroup II Formins
N-terminal structureContains signal peptide, transmembrane domainLacks transmembrane domain
Subcellular targetingCell membrane/endomembranesCytoplasmic/diverse locations
ExamplesAFH1, AFH3, FH5FH13
Function in pollen tubesPromote growth via membrane-originated actin cablesCan act as positive or negative regulators

Group I formins, including AFH3, have evolved a unique N-terminal structure with a signal peptide, a proline-rich potentially glycosylated extracellular domain, and a transmembrane domain that is not present in formins from other organisms . Group II formins like FH13 lack this transmembrane domain but can still influence pollen tube growth .

How can recombinant AFH3 be optimally expressed and purified for in vitro studies?

Based on available protocols for recombinant AFH3 production:

  • Expression System: E. coli is the preferred expression system, using the amino acid sequence 21-785 (excluding the signal peptide) fused to an N-terminal His-tag .

  • Purification Protocol:

    • Use affinity chromatography with Ni-NTA resin for initial purification

    • Follow with size-exclusion chromatography to enhance purity (>90% as determined by SDS-PAGE)

    • Final product should be lyophilized for stability

  • Storage Conditions:

    • Store lyophilized protein at -20°C/-80°C

    • For working solutions, reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add 5-50% glycerol (final concentration) and aliquot for long-term storage

    • Avoid repeated freeze-thaw cycles

  • Buffer Composition: Tris/PBS-based buffer with 6% trehalose at pH 8.0 is recommended for storage .

For optimal activity in actin polymerization assays, recombinant proteins containing both the FH1 and FH2 domains are preferable, as the FH1 domain modulates the activity of the FH2 domain in actin polymerization .

What biochemical assays can be used to characterize AFH3 activity in vitro?

Several complementary assays can characterize AFH3's actin-related activities:

  • Actin Nucleation Assay:

    • Mix purified recombinant AFH3 with pyrene-labeled G-actin

    • Monitor fluorescence increase as actin polymerizes

    • Compare nucleation rates with and without profilin

  • Barbed End Binding Assay:

    • Pre-form actin filaments with labeled seeds

    • Add AFH3 and monitor elongation rates

    • Determine if AFH3 functions as a tight capper or leaky capper

  • Total Internal Reflection Fluorescence (TIRF) Microscopy:

    • Directly visualize individual actin filament formation and elongation in real-time

    • Measure filament growth rates at barbed ends in the presence of AFH3

    • Compare with other formins to assess relative activity

  • Profilin Interaction Assay:

    • Use pulldown assays with the FH1 domain to assess profilin binding

    • Determine how profilin binding affects nucleation activity

The FH1 domain significantly modulates the activity of the FH2 domain. Studies with AFH1 showed that the FH2 domain alone functions as a tight capper (Kd ~3.7 nM) that allows only pointed-end growth, while the presence of the FH1 domain converts it to a leaky capper permitting barbed-end growth .

How does AFH3 interact with the Arp2/3 complex in regulating actin dynamics?

The relationship between formins like AFH3 and the Arp2/3 complex reveals a complex regulatory network:

  • Complementary Activities:

    • AFH3 promotes unbranched actin filament formation

    • The Arp2/3 complex generates branched actin networks

    • Both are capable of nucleating side-branched filaments in Arabidopsis epidermal cells

  • Competitive Dynamics:

    • Formins and the Arp2/3 complex compete for a limited supply of actin monomers

    • This competition prevents excessive activity of either nucleator

    • The balance between the two allows cells to generate different actin structures

  • Differential Growth Rates:

    • Formin-nucleated filaments grow faster (>2 μm/s) than Arp2/3-nucleated ones (1.25-1.5 μm/s)

    • Arp2/3-nucleated filaments are typically shorter than formin-nucleated ones

  • Unexpected Synergy:

    • Simultaneous inhibition of both the Arp2/3 complex and formins unexpectedly leads to increased actin filament abundance

    • This suggests regulatory mechanisms in plants differ from those in yeast and animal cells

These interactions indicate that studying AFH3 in isolation may not fully reveal its in vivo functions, as its activity is modulated by competition and coordination with the Arp2/3 complex.

What are the most effective genetic approaches for studying FH3 function in vivo?

Several genetic approaches have proven effective for studying formin function:

  • Loss-of-Function Analysis:

    • Generate AFH3 knockout or knockdown lines using T-DNA insertion or RNA interference

    • Specific downregulation of AFH3 eliminated actin cables in Arabidopsis pollen tubes

    • Combine with live-cell imaging of fluorescently labeled actin to assess cytoskeletal changes

  • Gain-of-Function Studies:

    • Create overexpression lines using pollen-specific promoters

    • Overexpression of AFH3 in tobacco pollen tubes induced excessive actin cables

    • Note that slight increases in expression can stimulate growth, while stronger overexpression can cause growth depolarization and arrest

  • Domain-Specific Mutations:

    • Generate plants expressing AFH3 with specific mutations in functional domains

    • For related proteins, mutations in the SWIM zinc finger domain (C579A, H591A) abolished transcriptional activity, while mutations in other domains (E323A) had no effect

    • Create YFP-tagged mutant versions to simultaneously assess localization and function

  • Promoter-Swapping Analysis:

    • Exchange promoters between AFH3 and related formins to distinguish between promoter activity differences and protein functional differences

    • This approach revealed that partially overlapping functions between FHY3 and FAR1 involve both promoter divergence and protein subfunctionalization

  • Chemical Genetics:

    • Use small molecule inhibitors like SMIFH2 (formin inhibitor) and CK-666 (Arp2/3 complex inhibitor)

    • Apply individually or in combination to distinguish roles of different actin nucleators

How can advanced microscopy techniques be optimized for visualizing AFH3-mediated actin dynamics?

To effectively visualize AFH3-mediated actin dynamics:

  • Live-Cell Imaging Optimization:

    • Use Lifeact-GFP or GFP-fABD2 as actin markers in stable transgenic lines

    • Employ variable-angle epifluorescence microscopy (VAEM) for higher resolution of cortical actin

    • Acquire time-lapse images at intervals of 1-2 seconds to capture rapid filament dynamics

  • Quantitative Parameters to Measure:

    • Filament elongation rates (μm/s)

    • Nucleation frequency (events/μm²/s)

    • Filament lifetime (seconds)

    • Severing frequency (events/μm/s)

    • Bundling frequency (events/μm²/s)

  • Dual-Channel Imaging:

    • Combine AFH3-mCherry with Lifeact-GFP to simultaneously visualize the protein and its effect on actin

    • Use high-speed spinning disk confocal microscopy for rapid multi-channel acquisition

  • Advanced Techniques for Higher Resolution:

    • Implement structured illumination microscopy (SIM) for resolution beyond the diffraction limit

    • Use single-molecule localization microscopy for nanoscale organization of AFH3 relative to actin filaments

In studies of actin nucleation in Arabidopsis epidermal cells, high spatiotemporal resolution fluorescence microscopy successfully demonstrated that the Arp2/3 complex and formins both nucleate side-branched actin filaments, with distinct growth rates and filament lengths .

What are the current knowledge gaps regarding AFH3 function in different cell types?

Several important knowledge gaps remain in understanding AFH3 function:

  • Cell-Type Specific Roles:

    • While AFH3's function in pollen tubes is well-characterized, its role in other cell types remains largely unknown

    • The function of most plant formins in non-pollen cells remains unclear despite genome-wide identification

  • Regulatory Mechanisms:

    • How AFH3 activity is regulated in response to developmental or environmental cues

    • Whether AFH3 is subject to autoinhibition like some animal and yeast formins

    • The signaling pathways that activate or inhibit AFH3

  • Interaction Partners:

    • The complete set of AFH3 interaction partners beyond actin and profilin

    • Whether AFH3 interacts with microtubules, as some formins coordinate microtubules and the actin cytoskeleton

  • Functional Redundancy:

    • The extent of functional overlap between AFH3 and other Group I formins

    • Whether compensation mechanisms exist when AFH3 is absent

  • Evolutionary Adaptation:

    • Why plant formins have evolved unique structural features (transmembrane domains) absent in other organisms

    • How these adaptations relate to plant-specific cellular processes

Further research using genetic, biochemical, and advanced imaging approaches is needed to address these knowledge gaps and fully understand the role of AFH3 in plant development and cellular function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.