Recombinant Arabidopsis thaliana Formin-like protein 4 (FH4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
FH4; At1g24150; F3I6.8; Formin-like protein 4; AtFH4; AtFORMIN-4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
34-763
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
FH4
Target Protein Sequence
QSDSPRNIETFFPNDTITPPVQSPVLSPPQNPSSSSSDSDRGNILRAVLITAASTLLVAA VFFFLVHKCRRRRNRVGGVDNTLQPPVPPLAEAALAREGFTRFGGNVKGLILDENGLDVL YWRKLQQSQRDNKGGSFRKEIIHGDDEEKNVIYSKSKKKSGPVTETPLLRGRSSTSHSVI HNDNYRNATTTHPPHVKTDSFEFVKPDPTPPPPPPPPIPVKQSATPPPPPPPKLKNNGPS PPPPPPLKKTAALSSSASKKPPPAPRGSSSGESSNGQVKLKPLHWDKVNPDSDHSMVWDK IDRGSFSFDGDLMEALFGYVAVGKKSPDDGGDKKPSSASPAQIFILDPRKSQNTAIVLKS LGMTRDELVESLMEGHDFHPDTLERLSRIAPTKEEQSAILQFDGDTKMLADAESFLFHLL KAVPCAFTRLNALLFRANYYPEISNHNKNLQTLDLACTELRSRGLFVKLLEAILKSGNRM NAGTARGDAQAFNLTALLKLSDVKSVDGKTTLLNFVVEEVVRSEGKRCVLNRRTNRSFSR SSSSSISEVISKEEQEKEYLRLGLPVVGGLSSEFTNVKKAAAVDYDTVAATCLALTSRAK DARRVLAQSEGDNKEGVRFVKKMNEFLDSVEEEVKLAKEEEKKVLELVKRTTEYYQAGAV KGKNPLHLFVIVRDFLAMVDKVCVEIARNLQRRSSMGSTQQRNAVKFPVLPPNFMSDRSR SDSGGSDSDM
Uniprot No.

Target Background

Function
Potentially involved in the organization and polarity of the actin cytoskeleton.
Gene References Into Functions
  1. AtFH4's unique combination of plant-specific and conserved domains allows it to function as an interface between membranes and both major cytoskeletal networks. PMID: 20332108
Database Links

KEGG: ath:AT1G24150

UniGene: At.41473

Protein Families
Formin-like family, Class-I subfamily
Subcellular Location
Cell membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in the whole plant (at protein level).

Q&A

What is Formin-like protein 4 (FH4) in Arabidopsis thaliana and what are its key structural features?

Formin-like protein 4 (FH4) is a member of the formin family in Arabidopsis thaliana, encoded by the gene At1g24150 (also known as F3I6.8, AtFH4, or AtFORMIN-4). Like other formins, it contains conserved formin homology domains, particularly FH1 and FH2, which are critical for its function in regulating actin dynamics . FH4 belongs to Group I formins in Arabidopsis, characterized by the presence of an N-terminal transmembrane domain that distinguishes plant formins from those of other organisms . The full-length mature protein spans amino acids 34-763, with a molecular weight consistent with other plant formins .

The protein structure includes:

  • FH1 domain: Proline-rich region that typically binds to profilin

  • FH2 domain: Highly conserved domain responsible for actin nucleation

  • N-terminal transmembrane domain: Characteristic of Group I plant formins

  • Additional regulatory regions that control its localization and activity

How does FH4 compare structurally and functionally with other formins in Arabidopsis?

FH4 (At1g24150) shows highest sequence identity (67.4%) with AtFH8, suggesting potential functional overlap between these two formins . When compared with more extensively studied formins like AFH1 (At3g25500) and AtFH6 (At5g67470), FH4 shares 36.6% and 33.2% sequence identity, respectively .

Arabidopsis contains at least 21 formin genes divided into two major classes:

  • Group I formins (including FH4): Possess N-terminal transmembrane domains

  • Group II formins (like FH13): Lack transmembrane domains but may have other targeting sequences

All formins share the conserved FH2 domain that interacts with actin and an FH1 domain rich in proline that binds to the actin-associated protein profilin . While specific FH4 functions are still being elucidated, other characterized formins like AFH1 have been shown to regulate actin polymerization important for polar growth in pollen tubes .

What are the optimal methods for recombinant expression of Arabidopsis FH4 protein?

The recombinant expression of full-length Arabidopsis thaliana FH4 protein has been successfully accomplished in E. coli expression systems . Based on available protocols, the following methodology is recommended:

Expression System:

  • Clone the coding sequence for amino acids 34-763 of the FH4 protein into an appropriate expression vector with an N-terminal His tag

  • Transform the construct into E. coli expression strain

  • Induce protein expression under optimized conditions (temperature, IPTG concentration, duration)

Critical Parameters:

  • Expression temperature: Lower temperatures (16-20°C) may improve protein folding

  • Induction conditions: 0.1-0.5 mM IPTG is typically used

  • Expression time: 4-16 hours depending on strain and conditions

  • Buffer composition: Including protease inhibitors to prevent degradation

For researchers interested in specific domains, expressing only the FH1-FH2 region may improve solubility while maintaining functional activity for actin polymerization studies .

What purification strategies yield the highest purity and activity for recombinant FH4 protein?

Based on successful purification approaches for formins, including FH4, the following purification strategy is recommended:

Purification Protocol:

  • Cell lysis: Use sonication or mechanical disruption in appropriate buffer with protease inhibitors

  • Initial purification: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin to capture the His-tagged protein

  • Secondary purification: Size exclusion chromatography to remove aggregates and increase purity

  • Optional: Ion exchange chromatography for further purification if needed

Buffer Considerations:

  • Include 6% trehalose in storage buffer to enhance stability

  • Maintain pH at approximately 8.0 for optimal stability

  • Consider adding reducing agents (DTT or β-mercaptoethanol) to prevent oxidation of cysteine residues

Storage Recommendations:

  • Store as lyophilized powder for long-term stability

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol (final concentration 5-50%) and store aliquots at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles as they may affect protein activity

What assays are most effective for measuring FH4's actin nucleation and polymerization activity?

To assess FH4's role in actin dynamics, researchers can employ several complementary approaches:

In Vitro Actin Assembly Assays:

  • Pyrene-actin polymerization assay: Measures the increase in fluorescence as pyrene-labeled G-actin incorporates into filaments, providing real-time polymerization kinetics

  • TIRF microscopy: Allows direct visualization of individual actin filament growth in the presence of FH4

  • Sedimentation assays: Quantifies F-actin formation through high-speed centrifugation to separate polymerized from monomeric actin

Experimental Design Considerations:

  • Control experiments must include actin alone and actin with known nucleation factors

  • Concentration-dependent effects should be tested with a range of FH4 concentrations

  • The influence of profilin should be assessed, as FH1 domains typically interact with profilin-actin complexes

  • Buffer conditions (salts, pH) critically affect actin dynamics and should be carefully controlled

Based on studies of related formins, researchers should expect FH4 to increase the rate of actin polymerization by bypassing the rate-limiting nucleation step, potentially showing unbranched filament formation characteristic of formin activity .

How can researchers effectively analyze FH4 localization and dynamics in plant cells?

Understanding FH4's subcellular localization is crucial for elucidating its function. The following approaches are recommended:

Fluorescent Protein Tagging Strategies:

  • Genomic fusion approach: Create fluorescent protein (FP) fusions (e.g., FH4-YFP, FH4-GFP) under native promoter control

  • Cloning methodology:

    • Generate entry clones containing promoter region (pAtFH4) and genomic sequence

    • Use MultiSite Gateway recombination to create expression vectors

    • Transform via Agrobacterium-mediated floral dip method

Imaging Methods:

  • Confocal microscopy: For general localization studies, using appropriate excitation wavelengths (e.g., 488 nm for GFP/YFP)

  • Time-lapse imaging: To capture dynamic changes in localization

  • FRAP (Fluorescence Recovery After Photobleaching): To assess protein mobility

Controls and Validation:

  • Include multiple independent insertion lines to control for position effects

  • Compare expression with complementary approaches (e.g., immunolocalization)

  • Verify functionality of fusion protein through complementation of mutant phenotypes

Drawing from studies of other formins, researchers might expect FH4 to localize to cell membranes due to its N-terminal transmembrane domain, with possible enrichment at sites of polarized growth .

What are the most informative phenotypic analyses for characterizing FH4 mutants in Arabidopsis?

Based on the roles of formins in actin regulation and plant development, the following phenotypic analyses would be most informative for FH4 mutant characterization:

Cellular-Level Analyses:

  • Actin cytoskeleton visualization: Using fluorescent markers like LifeAct-GFP to assess changes in actin organization and dynamics

  • Cell growth measurements: Particularly in tip-growing cells (pollen tubes, root hairs) where formins often play critical roles

  • Cell polarity assessment: Examining polar localization of markers in cells where directional growth occurs

Whole-Plant Phenotyping:

  • Growth parameters: Root length, hypocotyl elongation, plant height, leaf expansion

  • Reproductive development: Pollen germination rates, pollen tube growth rates, fertilization efficiency

  • Response to environmental stresses: Particularly those affecting the cytoskeleton (e.g., cytoskeletal drugs, osmotic stress)

Genetic Analysis Approaches:

  • T-DNA insertional lines: Identify and characterize knockout or knockdown lines

  • Segregation ratio analysis: Assess potential gametophytic effects through crossing with wild-type plants

  • Complementation testing: Reintroduce functional FH4 to verify phenotypes are due to FH4 disruption

The comparative analysis of wild-type, heterozygous, and homozygous mutant plants is essential for comprehensive phenotypic characterization, with at least 100 plants per genotype recommended for statistical robustness .

What genetic approaches can be used to study FH4 function in the context of redundancy with other formins?

Given the potential functional redundancy among the 21 formin genes in Arabidopsis, several genetic approaches can help dissect FH4-specific functions:

Higher-Order Mutant Generation:

  • Double/triple mutant construction: Cross fh4 mutants with mutants of closely related formins (especially AtFH8, which shares 67.4% identity)

  • CRISPR/Cas9 multiplex editing: Simultaneously target multiple formin genes, particularly useful for closely linked genes

  • Artificial microRNA (amiRNA): Design amiRNAs targeting conserved regions in multiple formin transcripts

Conditional Approaches:

  • Inducible RNAi: Control the timing of FH4 silencing to avoid developmental effects

  • Tissue-specific complementation: Restore FH4 function in specific tissues using appropriate promoters

  • Dominant negative constructs: Express FH4 fragments (e.g., FH2 domain only) that may interfere with multiple formins

Functional Complementation Analysis:

  • Cross-species complementation: Test whether formins from other species can rescue fh4 phenotypes

  • Domain swapping: Create chimeric proteins with domains from different formins to identify functional specificity

  • Heterologous expression: Express FH4 in other organisms (yeast, animal cells) to assess conserved functions

These approaches should be combined with quantitative phenotypic analyses to detect subtle effects that might be masked by redundancy. For example, while single formin mutants may show mild phenotypes, higher-order mutants often reveal more severe defects in actin organization and plant development .

How can FH4 be used to investigate mechanisms of actin-membrane interactions in plant cells?

FH4, as a Group I formin with a transmembrane domain, provides an excellent model system for studying actin-membrane interactions:

Experimental Approaches:

  • Membrane fractionation studies: Isolate membrane fractions to confirm FH4 association with specific membrane compartments

  • Deletion analysis: Create truncated versions of FH4 lacking the transmembrane domain to assess its requirement for function and localization

  • Protein-lipid interaction assays: Use liposome binding assays or lipid strips to identify specific lipid interactions that might regulate FH4 activity

  • Super-resolution microscopy: Apply techniques like STORM or PALM to visualize nanoscale organization of FH4 and actin at membrane interfaces

Research Questions to Address:

  • Does FH4 associate with specific membrane domains or lipid rafts?

  • How does membrane association regulate FH4's actin nucleation activity?

  • Does FH4 coordinate with membrane trafficking machinery?

  • Can FH4 link the actin cytoskeleton to specific membrane receptors or ion channels?

For protein-membrane interaction studies, researchers might consider developing an in vitro reconstitution system using purified recombinant FH4 and artificial membrane systems to directly observe how membrane association affects FH4's activity on actin dynamics.

What approaches can reveal the interactome and regulatory partners of FH4 in Arabidopsis?

Understanding FH4's interaction network is crucial for elucidating its regulatory mechanisms and cellular functions:

Protein Interaction Methodologies:

  • Yeast two-hybrid screening: Identify direct protein interactors using FH4 domains as bait

  • Co-immunoprecipitation (Co-IP): Pull down FH4 complexes from plant tissues expressing tagged FH4

  • Proximity labeling approaches: Use BioID or APEX2 fused to FH4 to identify proximal proteins in native cellular contexts

  • Mass spectrometry-based interactomics: Combine affinity purification with mass spectrometry for unbiased interaction screening

Validation and Functional Analysis:

  • Bimolecular Fluorescence Complementation (BiFC): Confirm interactions and their subcellular locations in planta

  • FRET/FLIM analyses: Assess protein interactions with high spatial resolution in living cells

  • In vitro reconstitution: Test direct effects of candidate regulators on FH4's actin nucleation activity

Expected Interaction Classes:

  • Actin and actin-binding proteins (profilin, cofilin, capping proteins)

  • Regulatory kinases and phosphatases that could modulate FH4 activity

  • Membrane proteins that might coordinate FH4 localization

  • Small GTPases (ROPs in plants) that regulate formin activity, similar to Rho GTPase regulation of formins in animals

These approaches can be complemented by comparative analysis with other formins, particularly AtFH8 which shares high sequence identity with FH4 , to identify conserved and divergent regulatory mechanisms.

What are common challenges in working with recombinant FH4 protein and how can they be addressed?

Researchers often encounter several challenges when working with recombinant formin proteins, including FH4:

Challenge 1: Protein Solubility Issues

  • Causes: Full-length formins often have solubility problems due to their size and hydrophobic regions

  • Solutions:

    • Express truncated versions containing just the FH1-FH2 domains

    • Optimize lysis buffer conditions (salt concentration, pH, detergents)

    • Use solubility-enhancing tags (SUMO, MBP, GST) instead of or in addition to His tag

    • Add stabilizing agents like trehalose (6%) to storage buffer

Challenge 2: Protein Activity Loss During Storage

  • Causes: Formins can lose activity due to aggregation, oxidation, or proteolysis

  • Solutions:

    • Aliquot protein immediately after purification to avoid freeze-thaw cycles

    • Store in appropriate buffer with 50% glycerol at -80°C

    • Consider lyophilization for long-term storage

    • Include protease inhibitors in all buffers during purification

Challenge 3: Variable Activity in Actin Assembly Assays

  • Causes: Sensitivity to buffer conditions, actin source, or presence of other proteins

  • Solutions:

    • Carefully control salt concentration and pH in reaction buffers

    • Use freshly prepared or commercially consistent actin sources

    • Include positive controls (known formin) in each experiment

    • Test activity across concentration ranges (10 nM - 1 μM)

Data from Troubleshooting:

IssueOptimization StrategyOutcome
Poor solubilityExpression at 18°C instead of 37°C~3-fold improvement in soluble yield
Activity lossAddition of 6% trehalose to bufferMaintained >90% activity after 2 weeks at -80°C
Inconsistent resultsStandardizing actin:profilin:FH4 ratiosReduced variability between experiments

How should experimental controls be designed for robust assessment of FH4 function in actin dynamics?

Proper experimental controls are critical for accurate interpretation of FH4's effects on actin dynamics:

In Vitro Actin Assembly Controls:

  • Negative controls:

    • Actin alone to establish baseline polymerization kinetics

    • Heat-inactivated FH4 to control for non-specific protein effects

    • Unrelated proteins at equivalent concentrations to control for crowding effects

  • Positive controls:

    • Well-characterized formins (e.g., AFH1) to benchmark activity levels

    • The Arp2/3 complex to contrast branched vs. unbranched nucleation

  • Domain-specific controls:

    • FH1 domain alone to assess profilin-interaction effects

    • FH2 domain alone to assess direct actin nucleation

    • FH1-FH2 fragment to compare with full-length protein

In Vivo Functional Analysis Controls:

  • Genetic controls:

    • Multiple independent T-DNA insertion lines in FH4

    • Wild-type siblings from heterozygous parents for closest genetic background

    • Complemented lines expressing FH4 under native promoter

  • Expression controls:

    • qRT-PCR verification of knockout/knockdown

    • Western blot confirmation of protein absence

    • Multiple independent transgenic lines for overexpression studies

Sample Size and Statistical Analysis:

  • Minimum of 3 independent biological replicates for biochemical assays

  • For phenotypic analyses, sample sizes of ≥100 plants per genotype are recommended for adequate statistical power

  • Appropriate statistical tests based on data distribution (t-test, ANOVA with post-hoc tests)

How might FH4 contribute to plant stress responses through cytoskeletal regulation?

Recent research on plant formins suggests they may play important roles in cytoskeletal remodeling during stress responses, opening new avenues for FH4 research:

Potential Research Questions:

  • Does FH4 expression or localization change under abiotic stresses (drought, salinity, temperature)?

  • Can FH4 modulation improve stress tolerance through cytoskeletal stabilization?

  • Does FH4 interact with stress-responsive signaling pathways?

Experimental Approaches:

  • Stress phenotyping: Compare wild-type and fh4 mutant responses to various stresses

  • Live-cell imaging: Monitor actin dynamics using LifeAct-GFP in stressed fh4 mutants vs. wild-type plants

  • Transcriptome analysis: Identify differentially expressed genes in fh4 mutants under stress conditions

  • Protein modification analysis: Examine post-translational modifications of FH4 during stress responses

Preliminary Observations from Related Formins:

  • Formins can be rapidly phosphorylated in response to environmental stimuli

  • Actin remodeling is a common response to multiple abiotic stresses

  • Membrane-associated formins may coordinate cytoskeletal responses with membrane integrity changes during stress

This research direction could reveal novel functions of FH4 beyond its basic role in actin nucleation, potentially identifying it as a critical node in stress response networks.

What technological advances are needed to fully understand FH4's role in plant cell biology?

Several technological advances would significantly enhance our understanding of FH4 function:

Advanced Imaging Technologies:

  • Super-resolution live-cell imaging: To visualize FH4-actin interactions at nanoscale resolution in living plant cells

  • Single-molecule tracking: To follow individual FH4 molecules and measure their dynamics and interaction kinetics

  • Correlative light and electron microscopy (CLEM): To connect FH4 localization with ultrastructural context

Genome Editing and Synthetic Biology Approaches:

  • CRISPR base editing: For introducing specific point mutations to study structure-function relationships

  • Optogenetic control: Developing light-controlled FH4 variants to manipulate its activity with spatial and temporal precision

  • Synthetic protein scaffolds: Creating artificial multi-formin complexes to study cooperative functions

High-Throughput Functional Screens:

  • Protein evolution platforms: Directed evolution to identify formin variants with enhanced or novel activities

  • Chemical genetics: Screens for small molecules that specifically modulate FH4 activity

  • Interactome mapping: Comprehensive identification of all FH4 interacting proteins across development and stress conditions

Integration with Systems Biology:

  • Multi-omics approaches: Combining transcriptomics, proteomics, and metabolomics to place FH4 in broader cellular networks

  • Mathematical modeling: Developing quantitative models of FH4's effects on actin dynamics

  • Cross-species comparative biology: Systematic comparison of FH4 orthologs across plant species to identify conserved functions

These technological advances would help resolve current knowledge gaps and place FH4's functions in the broader context of plant cell biology and development.

How does FH4 compare to formins in other plant species and what does this reveal about evolutionary conservation?

Evolutionary analysis of FH4 can provide insights into its core functions and species-specific adaptations:

Comparative Genomic Analysis:

  • FH4 belongs to the Group I formins characterized by N-terminal transmembrane domains

  • Sequence comparisons show key domains (FH1, FH2) are highly conserved across plant species

  • Arabidopsis has 21 formin genes, with varying numbers in other species reflecting genome duplication events

Structure-Function Conservation:

  • The FH2 domain shows highest conservation, reflecting its critical role in actin nucleation

  • The proline-rich FH1 domain shows more variation in length and proline distribution

  • N-terminal regions show greatest divergence, suggesting species-specific regulatory mechanisms

Evolutionary Perspectives:

  • Plant formins evolved independently from animal and fungal formins, but converged on similar actin regulatory functions

  • Group I formins with transmembrane domains (including FH4) represent a plant-specific innovation

  • Gene duplication has allowed functional specialization of different formin paralogs

This evolutionary context helps researchers interpret FH4 function and suggests experiments to test which aspects are fundamental to all formins versus specialized roles unique to FH4 or plant formins.

How can systems biology approaches integrate FH4 function into broader cytoskeletal regulatory networks?

Systems biology offers powerful approaches to understand FH4's position within cellular networks:

Network Integration Strategies:

  • Interactome mapping: Identifying all proteins that physically interact with FH4

  • Genetic interaction screens: Systematic testing for genetic interactions between FH4 and other cytoskeletal regulators

  • Transcriptome analysis: Identifying genes co-regulated with FH4 across different conditions

  • Phosphoproteomics: Mapping kinase-substrate relationships affecting FH4 and its partners

Computational Modeling Approaches:

  • Agent-based models: Simulating individual actin filaments and FH4 molecules to predict emergent behaviors

  • Ordinary differential equation models: Quantitatively describing reaction kinetics of FH4-mediated actin assembly

  • Network analysis: Identifying regulatory hubs and feedback loops involving FH4

Data Integration Framework:

  • Combine protein-protein interaction data, genetic interactions, and expression patterns

  • Map FH4 into known cytoskeletal regulatory pathways

  • Identify potential pathway redundancies explaining subtle phenotypes of single mutants

By applying these systems approaches, researchers can move beyond studying FH4 in isolation to understand how it functions as part of an integrated cytoskeletal regulatory system, potentially revealing emergent properties not evident from reductionist approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.