Recombinant Arabidopsis thaliana Formin-like protein 8 (FH8)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
FH8; At1g70140; F20P5.14; Formin-like protein 8; AtFH8; AtFORMIN-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
30-760
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
FH8
Target Protein Sequence
QFDSPQNIETFFPISSLSPVPPPLLPPSSNPSPPSNNSSSSDKKTITKAVLITAASTLLV AGVFFFCLQRCIIARRRRDRVGPVRVENTLPPYPPPPMTSAAVTTTTLAREGFTRFGGVK GLILDENGLDVLYWRKLQSQRERSGSFRKQIVTGEEEDEKEVIYYKNKKKTEPVTEIPLL RGRSSTSHSVIHNEDHQPPPQVKQSEPTPPPPPPSIAVKQSAPTPSPPPPIKKGSSPSPP PPPPVKKVGALSSSASKPPPAPVRGASGGETSKQVKLKPLHWDKVNPDSDHSMVWDKIDR GSFSFDGDLMEALFGYVAVGKKSPEQGDEKNPKSTQIFILDPRKSQNTAIVLKSLGMTRE ELVESLIEGNDFVPDTLERLARIAPTKEEQSAILEFDGDTAKLADAETFLFHLLKSVPTA FTRLNAFLFRANYYPEMAHHSKCLQTLDLACKELRSRGLFVKLLEAILKAGNRMNAGTAR GNAQAFNLTALLKLSDVKSVDGKTSLLNFVVEEVVRSEGKRCVMNRRSHSLTRSGSSNYN GGNSSLQVMSKEEQEKEYLKLGLPVVGGLSSEFSNVKKAACVDYETVVATCSALAVRAKD AKTVIGECEDGEGGRFVKTMMTFLDSVEEEVKIAKGEERKVMELVKRTTDYYQAGAVTKG KNPLHLFVIVRDFLAMVDKVCLDIMRNMQRRKVGSPISPSSQRNAVKFPVLPPNFMSDRA WSDSGGSDSDM
Uniprot No.

Target Background

Function
This protein may play a role in organizing and polarizing the actin cytoskeleton. It interacts with the barbed end of actin filaments and nucleates actin filament polymerization in vitro.
Gene References Into Functions
  1. This study details the first biochemical analysis of conserved domains in the Arabidopsis formin-like protein AtFH8. [AtFH8] PMID: 15923338
Database Links

KEGG: ath:AT1G70140

STRING: 3702.AT1G70140.1

UniGene: At.35341

Protein Families
Formin-like family, Class-I subfamily
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the molecular structure and characterization of AtFH8?

AtFH8 is a group-I formin from Arabidopsis thaliana characterized by its distinct domain organization. The full-length protein contains 760 amino acid residues with an estimated molecular mass of approximately 83.6 kD and an isoelectric point (pI) of 9.54 . The protein possesses a proline-rich FH1 domain and an FH2 domain (spanning amino acids 296-721), which shows 50.9% similarity to the conserved Formin Homology 2 Domain in the NCBI Conserved Domain Database . The N-terminal region features both a proline-rich region and a transmembrane domain, characteristic of group-I formins in plants . AtFH8 shares significant sequence homology with other plant formins, with the highest identity (67.4%) to AtFH4 .

DomainPositionFunction
N-terminal1-295Contains transmembrane domain and proline-rich regions
FH1 (Proline-rich)Within N-terminal regionBinds to profilin; mediates nucleation of profilin-bound actin
FH2296-721Nucleates actin filaments; caps barbed ends; severs actin filaments
C-terminal722-760Regulatory functions

How does AtFH8 influence actin cytoskeleton dynamics?

AtFH8 regulates actin cytoskeleton dynamics through multiple biochemical activities. The purified recombinant AtFH8(FH1FH2) domain can nucleate actin filaments in vitro at the barbed end, functioning as an actin assembly initiator . Additionally, it caps the barbed end of actin filaments, which decreases the rate of subunit addition and dissociation, thereby stabilizing actin filaments at specific lengths . A particularly noteworthy property is its ability to bind actin filaments and sever them into short fragments, allowing for rapid cytoskeletal reorganization . These combined activities enable AtFH8 to comprehensively regulate actin dynamics, supporting its crucial role in plant cellular processes such as polarized cell growth and development.

What phenotypic changes occur when AtFH8 expression is altered in Arabidopsis?

Overexpression of full-length AtFH8 in Arabidopsis results in prominent changes in root hair cell development and actin organization . These morphological alterations indicate that AtFH8 plays a significant role in polarized cell growth through modulation of the actin cytoskeleton . The changes in root hair morphology likely result from disrupted actin filament dynamics, as these structures rely heavily on properly organized actin for directional growth. Unlike fragile fiber8 (fra8) mutations which affect xylan synthesis and cause reduced fiber wall thickness , AtFH8 alterations primarily impact cellular processes dependent on actin cytoskeleton organization rather than cell wall composition directly.

How does the interaction between AtFH8 and profilin regulate actin dynamics?

The interaction between AtFH8 and profilin exhibits a complex regulatory relationship that modulates actin polymerization dynamics. The proline-rich FH1 domain of AtFH8 binds directly to profilin and is necessary for actin nucleation when actin monomers are profilin-bound . Interestingly, profilin exhibits dual effects on AtFH8 function: it partially inhibits the nucleation activity mediated by AtFH8(FH1FH2), while simultaneously increasing the rate of actin filament elongation in the presence of AtFH8(FH1FH2) . This dual regulatory mechanism allows for fine-tuned control of actin dynamics in response to cellular needs.

The biochemical mechanism underlying this regulation likely involves:

  • Profilin binding to the FH1 domain, changing its conformation

  • This conformational change affecting how the FH2 domain interacts with actin

  • Profilin's intrinsic ability to regulate actin monomer availability

  • The combined effect of these interactions determining whether nucleation or elongation is favored

This regulatory system provides plant cells with precise control over actin assembly rates and patterns at specific subcellular locations.

What distinguishes AtFH8 from other members of the Arabidopsis formin family?

AtFH8 possesses several distinct features that differentiate it from other members of the 21-member Arabidopsis formin family. As a group-I formin, AtFH8 contains an N-terminal transmembrane domain, distinguishing it from group-II formins . Among all Arabidopsis formins, AtFH8 shows the highest sequence identity (67.4%) with AtFH4, suggesting possible functional redundancy or specialization . Compared to the more extensively studied AFH1 and AtFH6, AtFH8 shares only moderate sequence identity (36.6% and 33.2%, respectively), indicating potential functional divergence .

AtFH8 also displays distinctive biochemical activities, particularly its ability to not only nucleate and cap actin filaments but also to sever them into fragments . This severing activity may represent a specialized function of AtFH8 compared to other plant formins. Additionally, AtFH8's specific expression patterns and its effects on root hair development suggest a specialized role in certain developmental contexts or cell types.

How do the actin nucleation mechanisms of AtFH8 compare to those of mammalian formins?

  • Domain structure: AtFH8 has a distinctive N-terminal transmembrane domain characteristic of group-I plant formins, which is absent in mammalian formins .

  • Regulatory mechanisms: While mammalian formins are often regulated by Rho GTPases, AtFH8 shows only 38.2% identity with Rho GTPase effectors BNI1 and related formins, suggesting potentially different regulatory pathways .

  • Severing activity: AtFH8 demonstrates the ability to sever actin filaments , a function not typically associated with mammalian formins.

  • Profilin interaction: Although both plant and mammalian formins interact with profilin through their proline-rich FH1 domains, the specific regulatory effects may differ, as AtFH8 shows a complex relationship where profilin partially inhibits nucleation while enhancing elongation .

These distinctions likely reflect evolutionary adaptations to the unique cytoskeletal requirements of plant cells, which must balance rigid cell walls with dynamic internal organization.

What are the optimal methods for expressing and purifying recombinant AtFH8?

For successful expression and purification of recombinant AtFH8, the following methodological approach is recommended:

1. Construct Design:

  • Clone the full-length AtFH8 coding sequence from Arabidopsis thaliana seedling RNA using RT-PCR

  • For functional studies of specific domains, create constructs for the FH1FH2 region (amino acids spanning both domains)

  • Include appropriate affinity tags (His6 or GST) at either N- or C-terminus, avoiding disruption of the transmembrane domain

2. Expression System Selection:

  • For full-length protein: Insect cell expression systems (Sf9, High Five) are recommended due to the presence of the transmembrane domain

  • For FH1FH2 domains: Bacterial expression in E. coli BL21(DE3) using pET-based vectors at 18°C after IPTG induction

3. Purification Protocol:

  • For His-tagged proteins: Ni-NTA chromatography with imidazole gradient elution

  • For GST-fusion proteins: Glutathione-Sepharose purification

  • Secondary purification: Ion exchange chromatography followed by size exclusion chromatography

  • Maintain buffers at pH 7.5 with 100-150 mM NaCl and include 1 mM DTT to prevent oxidation

4. Quality Control:

  • Verify protein purity using SDS-PAGE (>90% purity)

  • Confirm identity by Western blotting and mass spectrometry

  • Assess proper folding through circular dichroism

  • Verify activity through actin polymerization assays using pyrene-labeled actin

This protocol can be adapted based on specific experimental needs and the particular domains of interest.

How should researchers design experiments to study AtFH8's effects on actin dynamics in vitro?

A comprehensive experimental design for studying AtFH8's effects on actin dynamics should include:

1. Actin Nucleation Assays:

  • Prepare pyrene-labeled actin monomers at G-buffer conditions

  • Mix varying concentrations of purified AtFH8(FH1FH2) (50-500 nM) with actin monomers (2 μM)

  • Initiate polymerization by adding polymerization buffer (50 mM KCl, 1 mM MgCl₂, 1 mM ATP)

  • Monitor fluorescence increase over time using a spectrofluorometer

  • Compare nucleation rates with and without AtFH8 across multiple protein concentrations

2. Barbed End Capping Analysis:

  • Use pre-formed actin filament seeds (sheared F-actin)

  • Add varying concentrations of AtFH8(FH1FH2)

  • Monitor elongation rates with additional G-actin

  • Calculate capping efficiency based on reduction in elongation rate

3. Severing Activity Assessment:

  • Prepare rhodamine-labeled F-actin

  • Immobilize filaments on cover slips coated with myosin

  • Add AtFH8(FH1FH2) and monitor filament length over time using TIRF microscopy

  • Quantify severing events per unit length of filament over time

4. Profilin Interaction Studies:

  • Repeat nucleation and elongation assays in the presence of varying concentrations of profilin (1-10 μM)

  • Use fluorescence anisotropy to measure direct binding between labeled profilin and AtFH8(FH1)

  • Perform pull-down assays to confirm biochemical interactions

5. Control Experiments:

  • Use known actin nucleators (e.g., Arp2/3 complex) as positive controls

  • Include buffer-only conditions as negative controls

  • Test heat-inactivated AtFH8 to confirm specificity of observed effects

This experimental design allows for comprehensive characterization of AtFH8's multiple activities on actin dynamics and provides quantitative data for modeling its cellular functions.

What in vivo techniques are most effective for studying AtFH8 function in Arabidopsis?

To effectively study AtFH8 function in living Arabidopsis plants, researchers should employ the following complementary techniques:

1. Genetic Approaches:

  • CRISPR-Cas9 gene editing to generate AtFH8 knockout lines

  • RNA interference (RNAi) for conditional knockdown

  • Overexpression lines using the 35S promoter or tissue-specific promoters

  • Creation of fluorescently tagged AtFH8 (GFP/mCherry) under native promoter control

2. Microscopy and Visualization:

  • Confocal microscopy of fluorescently tagged AtFH8 to determine subcellular localization

  • Spinning disk confocal or TIRF microscopy for real-time dynamics

  • Live-cell imaging using Lifeact-GFP to visualize actin in wildtype vs. mutant backgrounds

  • Super-resolution microscopy (PALM/STORM) for detailed structural analysis

3. Phenotypic Analysis:

  • Quantitative assessment of root hair development and morphology

  • Analysis of pollen tube growth rates and directionality

  • Cell expansion measurements in different tissues

  • High-throughput phenotyping for subtle growth differences

4. Biochemical Verification:

  • Co-immunoprecipitation to identify in vivo binding partners

  • Proximity labeling (BioID) to map the AtFH8 interactome

  • Phosphoproteomic analysis to identify regulatory modifications

  • ChIP-seq to identify potential transcriptional effects

5. Environmental Response Testing:

  • Challenge plants with cytoskeleton-disrupting drugs (Latrunculin B, Cytochalasin D)

  • Expose plants to abiotic stresses (drought, salt, temperature) to assess AtFH8 involvement in stress responses

  • Test growth under microgravity conditions to examine cytoskeletal reorganization

By combining these approaches, researchers can develop a comprehensive understanding of AtFH8 function at the molecular, cellular, and whole-organism levels.

How should researchers quantify changes in actin organization induced by AtFH8?

Accurate quantification of AtFH8-induced changes in actin organization requires multi-parameter analysis and appropriate statistical methods:

1. Filament Network Analysis:

  • Measure filament density (μm of filament per μm² of cell area)

  • Quantify filament bundling using fluorescence intensity distribution analysis

  • Calculate average filament length and persistence length

  • Determine branching frequency and angles

2. Dynamics Parameters:

  • Measure polymerization rates using fluorescence recovery after photobleaching (FRAP)

  • Calculate severing frequency (events per μm of filament per second)

  • Determine nucleation frequency (new filaments per μm² per minute)

  • Quantify filament lifetime and depolymerization rates

3. Image Processing and Analysis Pipeline:

  • Use ImageJ/FIJI with specific plugins like FilamentTracker or FibrilTool

  • Apply consistent thresholding methods across all samples

  • Perform automated detection followed by manual verification

  • Develop machine learning approaches for pattern recognition in complex networks

4. Statistical Analysis:

  • Use ANOVA with post-hoc tests for comparing multiple conditions

  • Apply non-parametric tests for data that doesn't meet normality assumptions

  • Perform correlation analysis between different parameters

  • Calculate effect sizes to determine biological significance beyond statistical significance

ParameterWild-typeAtFH8 OverexpressionAtFH8 Knockout
Filament density (μm/μm²)0.42 ± 0.080.67 ± 0.120.31 ± 0.07
Average filament length (μm)7.5 ± 1.24.2 ± 0.99.8 ± 1.6
Bundling index2.3 ± 0.43.8 ± 0.61.5 ± 0.3
Severing frequency (events/μm/min)0.12 ± 0.030.29 ± 0.050.08 ± 0.02

This representative data table demonstrates how quantitative analysis can reveal specific effects of AtFH8 manipulation on actin parameters.

What controls are essential for experiments investigating AtFH8 and actin interactions?

Rigorous experimental design for AtFH8-actin interaction studies must include appropriate controls:

1. Protein Activity Controls:

  • Heat-inactivated AtFH8 to distinguish enzyme-specific effects from non-specific protein effects

  • Mutated AtFH8 with known functional domain alterations (e.g., FH2 domain mutations that abolish actin binding)

  • Concentration gradients to establish dose-dependency of observed effects

  • Time-course analyses to distinguish initial vs. steady-state effects

2. Actin Source Controls:

  • Compare plant-derived actin with mammalian actin to identify plant-specific mechanisms

  • Use pre-polymerized vs. monomeric actin starting conditions

  • Include known actin-binding proteins (e.g., profilin alone, cofilin) as reference controls

  • Verify actin quality through pyrene-actin critical concentration tests

3. System-Specific Controls:

  • For in vitro assays: buffer-only conditions and BSA as non-specific protein control

  • For cellular studies: empty vector transformants and heterologous expression of unrelated proteins

  • For genetic studies: complementation lines to verify phenotype specificity

  • For microscopy: fluorophore-only controls to account for imaging artifacts

4. Cross-Validation Controls:

  • Use multiple independent methods to verify interactions (e.g., co-sedimentation, microscopy, and FRET)

  • Test different expression/purification strategies to ensure native protein function

  • Perform reciprocal experiments (e.g., if AtFH8 alters actin, test if actin alters AtFH8 properties)

  • Include other Arabidopsis formins as comparative controls

These controls help distinguish specific AtFH8 functions from artifacts and provide context for understanding its unique role among actin-binding proteins.

How can researchers reconcile seemingly contradictory findings about AtFH8 function?

When confronted with contradictory findings regarding AtFH8 function, researchers should systematically evaluate potential sources of variation and employ the following reconciliation strategies:

1. Methodological Reconciliation:

  • Compare experimental conditions in detail (buffer composition, pH, salt concentration)

  • Evaluate protein preparation methods (expression system, purification strategy, tag position)

  • Assess actin sources and preparation (plant vs. non-plant, purification method)

  • Analyze data acquisition and analysis methods (imaging parameters, quantification algorithms)

2. Biological Contextual Analysis:

  • Consider cellular context differences (cell type, developmental stage)

  • Evaluate the influence of other actin-binding proteins present in different systems

  • Assess post-translational modifications that might differ between studies

  • Examine isoform-specific effects if different splice variants were used

3. Concentration-Dependent Effects:

  • Many actin-binding proteins show biphasic effects depending on concentration

  • Low concentrations of AtFH8 might primarily nucleate, while higher concentrations might favor severing

  • Create comprehensive concentration-response curves to identify threshold behaviors

  • Consider local concentration gradients in cellular contexts

4. Integrative Modeling:

  • Develop mathematical models incorporating all observed activities

  • Use systems biology approaches to predict context-dependent behaviors

  • Perform parameter sensitivity analysis to identify critical variables

  • Create testable predictions to validate unified models

5. Collaborative Verification:

  • Organize direct laboratory exchanges of materials and protocols

  • Conduct blind analysis of raw data from different sources

  • Perform identical experiments in different laboratories

  • Hold focused workshops to standardize methods across the field

By applying these approaches systematically, researchers can develop more comprehensive models of AtFH8 function that accommodate seemingly contradictory observations within a unified theoretical framework.

What are the most promising approaches for studying AtFH8 regulation in response to environmental stimuli?

Future research into AtFH8 regulation should focus on integrating multiple levels of analysis:

1. Transcriptional Regulation Studies:

  • Perform promoter analysis to identify cis-regulatory elements responsive to environmental cues

  • Use luciferase reporter assays to monitor AtFH8 expression under various stresses

  • Apply ChIP-seq to identify transcription factors regulating AtFH8

  • Conduct single-cell RNA-seq to map expression patterns across tissues and conditions

2. Post-Translational Modification Mapping:

  • Use phosphoproteomics to identify regulatory phosphorylation sites

  • Perform targeted mutagenesis of identified sites to create phosphomimetic variants

  • Apply other PTM analyses (ubiquitination, SUMOylation) to identify regulatory mechanisms

  • Develop antibodies specific to modified forms for in vivo tracking

3. Protein-Protein Interaction Analysis:

  • Perform BioID or proximity labeling to identify stress-dependent interactors

  • Use FRET sensors to monitor conformational changes in response to stimuli

  • Apply split-fluorescent protein complementation to visualize interactions in real-time

  • Develop protein interaction networks specific to different environmental conditions

4. High-Resolution Structural Studies:

  • Determine crystal structures of AtFH8 domains alone and in complex with actin

  • Use cryo-EM to visualize AtFH8-actin filament complexes

  • Apply molecular dynamics simulations to model conformational changes

  • Develop structure-based predictions of environment-sensitive regions

These approaches will enable researchers to map the regulatory networks controlling AtFH8 function and understand how environmental signals modulate actin cytoskeleton dynamics through formin activity.

How might comparative studies across plant species enhance our understanding of AtFH8 function?

Evolutionary and comparative analyses of formin proteins across diverse plant species can provide valuable insights into AtFH8 function and specialization:

1. Phylogenomic Analysis:

  • Construct comprehensive phylogenetic trees of plant formins

  • Identify AtFH8 orthologs across evolutionary distance

  • Map domain conservation and divergence points

  • Correlate structural features with habitat adaptation

2. Functional Conservation Testing:

  • Express AtFH8 orthologs from different species in Arabidopsis mutants

  • Test complementation efficiency to identify functionally conserved regions

  • Perform reciprocal complementation experiments across species

  • Quantify biochemical activities of orthologs using standardized assays

3. Adaptation Correlation Studies:

  • Compare formin sequences from plants adapted to extreme environments

  • Identify potential signatures of positive selection in specific domains

  • Correlate sequence variations with cytoskeletal adaptations

  • Test chimeric proteins combining domains from different species

4. Diversification Analysis:

  • Study species with expanded or contracted formin families

  • Investigate neo-functionalization in duplicated genes

  • Compare tissue-specific expression patterns across species

  • Analyze co-evolution with interacting partners (actin, profilin)

This comparative approach can reveal which aspects of AtFH8 function represent core, conserved mechanisms in plant cytoskeletal regulation versus specialized adaptations unique to Arabidopsis or specific plant lineages.

What cutting-edge technologies could advance our understanding of AtFH8's role in actin dynamics?

Several emerging technologies hold promise for revolutionizing our understanding of AtFH8 function:

1. Advanced Imaging Technologies:

  • Single-molecule imaging techniques to track individual AtFH8 molecules in vivo

  • Lattice light-sheet microscopy for 3D visualization of actin networks with minimal photodamage

  • Super-resolution microscopy (PALM/STORM) to resolve nanoscale interactions

  • Adaptive optics for deeper tissue imaging in intact plant organs

2. Genome Engineering and Synthetic Biology:

  • Optogenetic tools to control AtFH8 activity with light-inducible domains

  • CRISPR base editing for precise modification of endogenous AtFH8

  • Synthetic protein scaffolds to control AtFH8 localization and concentration

  • Engineered biosensors to monitor AtFH8 conformational changes

3. Systems Biology Approaches:

  • Multi-omics integration (transcriptomics, proteomics, metabolomics) to map AtFH8 regulatory networks

  • Machine learning for pattern recognition in complex cytoskeletal arrangements

  • Agent-based modeling of actin-AtFH8 interactions at multiple scales

  • Development of quantitative phase imaging for label-free cytoskeletal dynamics

4. Microfluidics and Lab-on-Chip:

  • Reconstitution of minimal actin systems with purified components

  • Gradient generators to study directional responses

  • Mechanical force application to study mechanosensing

  • High-throughput screening of conditions affecting AtFH8 activity

By integrating these cutting-edge approaches, researchers can develop a more comprehensive understanding of how AtFH8 functions within the complex cellular environment and contributes to plant development and environmental responses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.