Recombinant Arabidopsis thaliana Formin-like protein 9 (FH9)

Shipped with Ice Packs
In Stock

Description

Protein Structure and Domains

Formin-like protein 9 (FH9) from Arabidopsis thaliana is a large multidomain protein characterized by the presence of highly conserved formin homology domains that are characteristic of the formin family. The recombinant form of FH9 protein consists of 758 amino acids (residues 25-782) of the mature protein, containing the key functional domains typical of plant formins . Like other formins, FH9 contains the signature FH1 (Formin Homology 1) and FH2 (Formin Homology 2) domains that are critical for its function in actin dynamics .

The FH2 domain represents the most highly conserved region across all formins and is responsible for direct interaction with actin, facilitating the nucleation and elongation of unbranched actin filaments. This domain enables formins to function as potent actin nucleators independent of the Arp2/3 complex, which is responsible for branched filament formation . The proline-rich FH1 domain, positioned N-terminally to FH2, serves as a binding site for profilin, an actin-binding protein that regulates actin polymerization by controlling the availability of actin monomers .

Sequence analysis reveals that FH9 shares significant structural similarities with other plant formins, particularly with AtFH4, with which it shares 67.4% sequence identity. This high degree of similarity suggests functional conservation between these two proteins . When compared with other experimentally characterized Arabidopsis formins, FH9 shows 36.6% identity with AFH1 (At3g25500) and 33.2% identity with AtFH6 (At5g67470) .

Recombinant Production and Characteristics

The recombinant form of FH9 used in research is typically expressed in E. coli expression systems with an N-terminal His-tag to facilitate purification. The commercially available recombinant protein (catalog number RFL15732AF) is produced in this manner and supplied as a lyophilized powder . The His-tag enables efficient purification using affinity chromatography and allows for easy detection in experimental settings .

The amino acid sequence of FH9 includes specific motifs that contribute to its functional properties. A partial sequence includes: "STVTLSRRLLYDYESPLPLPLSPISPPFFPLESSPPSPPPPLPPTPPTTFAVFPTFPANISALVLPRSSKPHHTSPTLLLPALSAVLVIATVIGLALFLYGRHRGQTRHLKNS" . This sequence contains characteristic features that may contribute to its function in actin regulation and potential membrane localization.

Membrane Localization and Cellular Function

Group Ie formins in Arabidopsis, including AtFH4 and AtFH8, have been shown to localize to specific domains at the cell membrane, particularly at the borders between adjoining cells . This specific localization pattern suggests that these formins function in regulating actin polymerization at distinct membrane sites, potentially contributing to cell-cell communication or targeted growth processes.

The subcellular localization of AtFH4 and AtFH8 has been observed using indirect immunofluorescence and GFP fusion constructs, respectively. These studies revealed that aberrant expression of AtFH8 resulted in the inhibition of root hair elongation, demonstrating the importance of proper formin function in cell expansion processes . Given the structural similarity between FH9 and these well-characterized formins, FH9 may exhibit similar localization patterns and functions in cell expansion.

Potential Interactions with Other Proteins

Formins interact with various proteins to regulate actin dynamics. One of the key interacting partners is profilin, an actin-binding protein that promotes actin polymerization by facilitating the addition of actin monomers to growing filaments. Studies on AtFH4 have demonstrated isoform-specific interactions with profilin both in vitro and in vivo, suggesting precise functional specialization .

Based on structural similarity, FH9 likely interacts with profilin and potentially other actin-binding proteins to coordinate actin dynamics in specific cellular contexts. These interactions may enable FH9 to respond to cellular signals and participate in regulated actin remodeling during various developmental and environmental responses.

Role in Plant Development and Growth

Studies on other Arabidopsis formins have demonstrated their importance in various aspects of plant development. For instance, aberrant expression of AtFH8 has been shown to inhibit root hair elongation, indicating its role in cell expansion processes . Given the structural similarity between FH9 and other characterized formins, FH9 may play comparable roles in regulating cell growth and morphogenesis.

Functional Comparison with Other Formins

The functional properties of AtFH4 and AtFH8, members of the group Ie clade of Arabidopsis formin homologues, provide clues about the potential functions of FH9. AtFH4 affects actin dynamics in vitro and interacts with profilin isoforms in a specific manner . These proteins localize to specific cell membrane domains and influence cell expansion processes, as evidenced by the inhibition of root hair elongation upon aberrant expression of AtFH8 .

Formin ProteinSequence Identity with FH9Known FunctionsSubcellular Localization
AtFH4 (At1g24150)67.4%Affects actin dynamics, interacts with profilinCell membrane at borders between cells
AFH1 (At3g25500)36.6%Actin nucleation, pollen tube growth regulationNot specified in search results
AtFH6 (At5g67470)33.2%Involved in nematode infection processesNot specified in search results
AtFH8Not specifiedInhibits root hair elongation when aberrantly expressedCell membrane zones

Use as a Research Tool

Recombinant FH9 protein serves as a valuable tool for studying actin cytoskeleton dynamics in plants. The availability of purified FH9 allows researchers to investigate its biochemical properties, including its effects on actin polymerization, interactions with other proteins, and responses to various signals. Such studies contribute to our understanding of cytoskeletal regulation in plants and its implications for plant growth and development.

The recombinant protein can be used in various experimental approaches, including in vitro actin polymerization assays, protein-protein interaction studies, and structural analyses. These investigations help elucidate the molecular mechanisms underlying FH9 function and its contributions to cellular processes.

Potential Biotechnological Applications

Understanding the functions of plant formins like FH9 may have implications for biotechnological applications. The actin cytoskeleton plays crucial roles in plant responses to environmental stresses, pathogen defense, and growth regulation. By manipulating formin expression or activity, it may be possible to enhance plant resilience to stresses or improve agronomically important traits.

Additionally, insights into how formins regulate actin dynamics can inform the development of novel cytoskeleton-targeting compounds or strategies for modifying plant architecture. Such approaches could have applications in agriculture, horticulture, and bioenergy production.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
FH9; At5g48360; K23F3_8; Formin-like protein 9; AtFH9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-782
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
FH9
Target Protein Sequence
STVTLSRRLLYDYESPLPLPLSPISPPFFPLESSPPSPPPPLPPTPPTTFAVFPTFPANI SALVLPRSSKPHHTSPTLLLPALSAVLVIATVIGLALFLYGRHRGQTRHLKNSHCSSSNT SSYGDEQSHITTNFNMAATTSPSEVFYLNTEESDHIRTGGTFFLKQDSPEIRPLPPLPPR SFHHNNYETEVNEEDEEEEEDVFFSPMASLPGSANSSPSHSCSSSCSGWVSPARSFSITM SPPNPRYSDATNLQSPSPERLRVRKNYNGNGSSSLRMFSFWNQNMGFGFPRISSASTSPD RGFIRTPLSSLYSSVSTSPDGLFRKFLDSSPPIWNDFSRNVKSVLLSHTASSRRDFVINI GESSSQQSKVPALPPPTRPPPLVPPSQPFVVQNDVKKQSFSDQPPKQLHWERLRSSSSKL SKEMVETMFIANSSNPRDLPIQNQVLDPRKAQNIATLLQLLNLSTKDVCQALLDGDCDVL GAELLECLSRLAPSKEEERKLKSFSDGSEIGPAERFLKELLHVPFVFKRVDALLFVANFH SEIKRLRKSFSVVQVACEELRNSRMFSILLEAILKTGNMMSVRTNRCGDADAFKLDTLLK LVDVKGLDGRSSLLHFVVQEMMKSEGSVRALEGIRNLNTELSNVKKSADIEYGVLRSNVS RICQGLKNIEALLLLSEESGSYGDQWLKFKERMTRFLKTAAEEIVKIKIRESSTLSALEE VTEQFHGDASKEGHTMRIFMIVRDFLSVLDQVCKEMGD
Uniprot No.

Target Background

Function
Putative involvement in the organization and polarity of the actin cytoskeleton.
Database Links

KEGG: ath:AT5G48360

STRING: 3702.AT5G48360.1

UniGene: At.29853

Protein Families
Formin-like family, Class-I subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the function of Formin-like protein 9 (FH9) in Arabidopsis thaliana?

Formin-like protein 9 (FH9) in Arabidopsis thaliana belongs to the formin family of proteins that play crucial roles in cytoskeletal organization. While specific FH9 functions are still being elucidated, research on other Arabidopsis formins, such as Class II formin FH13, demonstrates their involvement in modulating pollen tube growth and actin cytoskeleton organization. Class II formins are now understood as modulators of cellular processes rather than simply components of growth machinery. By extrapolation, FH9 likely contributes to cytoskeletal dynamics in specific tissues or developmental stages of Arabidopsis, potentially influencing cell morphogenesis, growth directionality, or intracellular trafficking .

How do formins differ from other cytoskeletal regulatory proteins in plants?

Formins represent a distinct class of actin-binding proteins that nucleate and elongate actin filaments. Unlike other cytoskeletal regulators, formins in Arabidopsis directly coordinate both actin remodeling and exocytosis at growing cell tips, particularly in tip-growing cells. For example, research on FH13 and other formins shows they contribute to organization of the actin fringe in pollen tubes, with their loss leading to structural defects in subapical actin. This dual functionality distinguishes formins from other regulators that might influence only bundling, severing, or capping of existing filaments. The specialized domains in formins allow them to interact with both the plasma membrane and actin monomers simultaneously, creating a unique bridge between the cell's structural and signaling systems .

What expression systems are suitable for producing recombinant Arabidopsis FH9?

Based on successful approaches with similar proteins, several expression systems are viable for recombinant Arabidopsis FH9 production:

  • Arabidopsis seed-based expression system: Using seed-specific promoters like β-PHASEOLIN (PPHAS) to drive expression can yield high protein accumulation (5-10% of total soluble protein), though it may trigger unfolded protein response (UPR) in the endoplasmic reticulum .

  • Arabidopsis oil body expression system: Similar to the technique used for rhFGF9, where the recombinant protein is expressed as a fusion with oleosin in oil bodies via the floral dip transformation method. This system allows for relatively simple protein purification through oil body isolation .

  • Bacterial expression systems: While not detailed in the search results, E. coli systems are commonly used for recombinant plant protein production, particularly when functional analyses rather than post-translational modifications are the primary goal.

The choice depends on research requirements, with plant-based systems offering advantages for proteins requiring plant-specific post-translational modifications.

How can I design experiments to analyze FH9's influence on actin cytoskeleton dynamics?

Experimental design for analyzing FH9's influence on actin dynamics should incorporate multiple complementary approaches:

  • Genetic manipulation strategies:

    • Generate knockout/knockdown lines using T-DNA insertion or CRISPR-Cas9

    • Create overexpression lines using native or constitutive promoters

    • Develop fluorescent protein-tagged FH9 transgenic lines under native promoter control

  • Cytoskeletal visualization techniques:

    • Employ live-cell imaging with fluorescent actin markers (e.g., Lifeact-GFP) in wild-type versus mutant backgrounds

    • Use fixed-cell visualization with phalloidin staining for higher resolution imaging

    • Implement super-resolution microscopy for detailed actin structure analysis

  • Functional assays:

    • Analyze growth parameters of tip-growing cells (pollen tubes, root hairs)

    • Assess cellular responses to actin-disrupting drugs in wild-type versus mutant lines

    • Examine protein-protein interactions through co-immunoprecipitation to identify FH9 binding partners

This multi-faceted approach parallels successful strategies used with other formins like FH13, where expression of fluorescent protein-tagged FH13 under its native promoter revealed non-homogeneous distribution in pollen tube cytoplasm, providing insights into its function .

What cellular phenotypes might result from FH9 overexpression or knockout?

Based on phenotypes observed with other Arabidopsis formins, FH9 manipulation may produce the following cellular effects:

Genetic ManipulationExpected Cellular PhenotypesMolecular Consequences
FH9 Knockout/Knockdown- Potential alterations in actin organization
- Possible changes in cell elongation rate
- Potential impacts on directional growth
- Disruption of normal actin dynamics
- Altered vesicle trafficking
- Potential compensatory upregulation of other formins
FH9 Overexpression- Excessive actin cable formation
- Potential cell tip swelling
- Possible loss of cell polarity
- Imbalance in actin dynamics
- Disruption of the fine actin fringe
- Altered vesicle targeting

This prediction is supported by observations of other formin mutants, where Class II formin FH13 knockout resulted in stimulation of pollen tube growth while overexpression inhibited elongation, suggesting a role in controlling or limiting cell growth . Similarly, overexpression of Arabidopsis FH1 in tobacco pollen tubes caused growth arrest and tip swelling due to disrupted actin dynamics .

How does FH9 interact with other components of the cytoskeletal regulatory network?

While specific FH9 interactions await experimental verification, research on related formins suggests probable interaction networks:

  • Actin-related interactions:

    • Direct binding to G-actin for nucleation and elongation activities

    • Potential competitive or cooperative interactions with profilins (critical for formin function)

    • Possible regulation by small GTPases that control formin activation

  • Membrane associations:

    • Interactions with phospholipids for localization to specific membrane domains

    • Potential associations with exocytotic vesicles, similar to lily formin LlFH1 localization to vesicles at the leading edge of the actin fringe

  • Signaling components:

    • Regulatory interactions with kinases that may modulate formin activity through phosphorylation

    • Possible calcium-dependent regulation, particularly important in tip-growing cells

Understanding these interactions is crucial, as research has shown that the balance between profilin and formin contributes to determination of growth rates in structures like pollen tubes .

What is the most effective protocol for expressing recombinant FH9 in Arabidopsis?

For recombinant FH9 expression in Arabidopsis, a comprehensive protocol would include:

  • Vector construction:

    • Clone the full-length FH9 cDNA into an appropriate entry vector (e.g., pENTR/D-TOPO)

    • Recombine into a destination vector containing a seed-specific promoter (e.g., β-PHASEOLIN) or tissue-specific promoter

    • Add epitope tags (FLAG, HA) or fluorescent protein fusions for detection and localization studies

    • Include appropriate selection markers (e.g., glufosinate resistance)

  • Transformation procedure:

    • Use Agrobacterium-mediated transformation via the floral dip method

    • Select primary transformants on appropriate antibiotics/herbicides

    • Advance to homozygous T3 or T4 generation for stable expression

  • Expression verification:

    • Confirm transgene presence by PCR and expression by RT-PCR

    • Verify protein production using SDS-PAGE and Western blotting with tag-specific antibodies

    • Quantify expression levels relative to total soluble protein

This approach builds on successful methods used for other recombinant proteins in Arabidopsis, such as the expression of oleosin-rhFGF9 fusion proteins and antibody fragments that achieved expression levels of 5-10% of total soluble protein .

How can I assess the functional activity of recombinant FH9?

Assessing recombinant FH9 functional activity requires multiple complementary approaches:

  • In vitro biochemical assays:

    • Actin polymerization assays measuring nucleation and elongation rates

    • Pyrene-actin assays to quantify polymerization kinetics

    • Microscopy-based assays visualizing filament formation

  • Cellular assays:

    • Cell proliferation assays (e.g., MTT assays with NIH/3T3 cells), similar to those used for oleosin-rhFGF9 testing

    • Examination of cytoskeletal organization in transgenic plants

    • Analysis of growth parameters in tissues expressing the recombinant protein

  • Binding partner identification:

    • Co-immunoprecipitation followed by mass spectrometry (IP-MS) to identify interacting proteins

    • Yeast two-hybrid screens for protein-protein interactions

    • Bimolecular fluorescence complementation (BiFC) to verify interactions in planta

When evaluating functional activity, it's essential to include appropriate controls, such as wild-type plants and established formin mutants, to provide reference points for observed phenotypes and activities.

What purification strategies are most effective for recombinant FH9 from Arabidopsis?

Effective purification of recombinant FH9 from Arabidopsis tissues depends on the expression system and protein fusion design:

  • Oil body-based purification (if using oleosin fusion strategy):

    • Homogenize transgenic seeds to release oil bodies

    • Isolate oil bodies through flotation centrifugation

    • Release the target protein through enzymatic cleavage or chemical methods

    • This approach parallels the oleosin-rhFGF9 expression system, which produced functional protein

  • Affinity chromatography (for tagged proteins):

    • Extract total protein using appropriate buffers

    • Purify using anti-FLAG, anti-HA, or other tag-specific affinity matrices

    • Elute using competitive binding or pH changes

    • This method has been successfully used for purification of tagged proteins like HDA9-3xFLAG and PWR-3xFLAG from Arabidopsis

  • Size exclusion and ion exchange chromatography:

    • As secondary purification steps to increase purity

    • Separate based on molecular size or charge properties

    • Combine with affinity methods for highest purity

Purification yield and protein activity should be monitored at each step using SDS-PAGE, Western blotting, and functional assays to ensure the integrity of the recombinant protein.

How can I identify and confirm FH9 mutants through mapping-by-sequencing?

Identifying and confirming FH9 mutants through mapping-by-sequencing involves a systematic approach:

  • Mutant generation and screening:

    • Create a mutagenized population using EMS or other mutagens

    • Screen for phenotypes potentially related to cytoskeletal defects

    • Backcross mutants to wild-type or mapping parents

  • Mapping-by-sequencing procedure:

    • Select mutant plants from a segregating population based on phenotype

    • Extract DNA from a bulk of mutant individuals (30-50 plants)

    • Perform whole-genome sequencing at appropriate coverage (30-40x)

    • Analyze data using bioinformatics pipelines to identify causal mutations

  • Mutation confirmation:

    • Verify mutations through Sanger sequencing

    • Perform complementation tests with known alleles or transgenic complementation

    • Analyze multiple independent alleles when possible

This approach follows established mapping-by-sequencing protocols for Arabidopsis that have successfully identified causal mutations in various genetic screens .

What phenotypic analyses are most informative for understanding FH9 function?

The most informative phenotypic analyses for understanding FH9 function include:

Phenotypic analyses should compare multiple genetic backgrounds (wild-type, knockout, knockdown, overexpression) under various environmental conditions to comprehensively understand FH9's function, similar to approaches used for characterizing FH13's role in pollen tube growth .

How can I visualize FH9 localization and dynamics in living cells?

Visualizing FH9 localization and dynamics in living cells requires sophisticated imaging approaches:

  • Fluorescent protein fusion design:

    • Create N- and C-terminal fluorescent protein fusions (GFP, mCherry, etc.)

    • Express under native promoter to maintain physiological expression patterns

    • Validate functionality of fusion proteins through complementation tests

  • Advanced microscopy techniques:

    • Confocal laser scanning microscopy for high-resolution localization

    • Spinning disk confocal microscopy for rapid time-lapse imaging

    • Super-resolution techniques (STED, PALM, SIM) for detailed structural analysis

    • FRAP (Fluorescence Recovery After Photobleaching) to measure protein dynamics

  • Co-visualization approaches:

    • Simultaneous imaging with actin markers (Lifeact, mTalin)

    • Dual-color imaging with vesicle or membrane markers

    • Multi-color imaging with other cytoskeletal components

This methodological approach parallels successful visualization strategies for other formins, such as the non-homogeneous distribution of fluorescent protein-tagged FH13 in pollen tube cytoplasm that provided insights into its cellular function .

What considerations are important when comparing FH9 with other formin family members?

When comparing FH9 with other formin family members, several key considerations are essential:

  • Structural and sequence analysis:

    • Detailed comparison of functional domains (FH1, FH2, etc.)

    • Analysis of conserved versus divergent motifs

    • Evaluation of potential regulatory regions

  • Expression pattern differences:

    • Tissue-specific and developmental expression profiles

    • Response to environmental or hormonal stimuli

    • Co-expression analysis with potential interacting partners

  • Functional redundancy assessment:

    • Generation and analysis of higher-order mutants

    • Complementation tests between different formin family members

    • Cross-species complementation studies

  • Evolutionary context:

    • Phylogenetic analysis across plant species

    • Comparison with animal formins to identify plant-specific features

    • Analysis of selection pressure on different formin domains

When conducting comparative analyses, it's important to recognize the distinct functional roles of Class I versus Class II formins, as research has shown their differentiated contributions to processes like pollen tube growth .

How can I address potential unfolded protein response triggering during recombinant FH9 expression?

Addressing unfolded protein response (UPR) during recombinant FH9 expression requires strategic approaches:

  • Monitoring UPR activation:

    • Analyze transcriptome changes using microarrays or RNA-seq

    • Look for upregulation of UPR marker genes related to protein folding, glycosylation, translocation, and degradation

    • Quantify expression of specific UPR components through qPCR

  • Mitigation strategies:

    • Optimize codon usage for efficient translation

    • Co-express molecular chaperones to assist protein folding

    • Consider temporal regulation of expression to prevent overwhelming the ER

  • Expression system adjustments:

    • Test different promoters with varying expression strengths

    • Explore alternative subcellular targeting (cytosol, chloroplast)

    • Evaluate different plant tissues for expression (seeds vs. leaves)

What are the key experimental controls needed for FH9 functional studies?

Robust FH9 functional studies require comprehensive controls:

  • Genetic controls:

    • Wild-type plants (same ecotype as mutants)

    • Multiple independent transgenic/mutant lines

    • Complementation lines restoring FH9 function in mutant background

    • Empty vector controls for transformation effects

  • Protein expression controls:

    • Non-functional FH9 variants (domain mutations)

    • Appropriate tags-only controls for fusion proteins

    • Expression level verification across experimental lines

  • Assay-specific controls:

    • Positive controls using known actin-modulating proteins

    • Negative controls excluding essential components

    • Dose-response controls for pharmacological treatments

    • Time-course controls for dynamic processes

  • Technical controls:

    • Biological and technical replicates

    • Randomization and blinding where appropriate

    • Internal standards for quantitative measurements

Implementing these controls ensures that observed phenotypes can be confidently attributed to FH9 function rather than experimental artifacts or secondary effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.