Formin-like protein 9 (FH9) from Arabidopsis thaliana is a large multidomain protein characterized by the presence of highly conserved formin homology domains that are characteristic of the formin family. The recombinant form of FH9 protein consists of 758 amino acids (residues 25-782) of the mature protein, containing the key functional domains typical of plant formins . Like other formins, FH9 contains the signature FH1 (Formin Homology 1) and FH2 (Formin Homology 2) domains that are critical for its function in actin dynamics .
The FH2 domain represents the most highly conserved region across all formins and is responsible for direct interaction with actin, facilitating the nucleation and elongation of unbranched actin filaments. This domain enables formins to function as potent actin nucleators independent of the Arp2/3 complex, which is responsible for branched filament formation . The proline-rich FH1 domain, positioned N-terminally to FH2, serves as a binding site for profilin, an actin-binding protein that regulates actin polymerization by controlling the availability of actin monomers .
Sequence analysis reveals that FH9 shares significant structural similarities with other plant formins, particularly with AtFH4, with which it shares 67.4% sequence identity. This high degree of similarity suggests functional conservation between these two proteins . When compared with other experimentally characterized Arabidopsis formins, FH9 shows 36.6% identity with AFH1 (At3g25500) and 33.2% identity with AtFH6 (At5g67470) .
The recombinant form of FH9 used in research is typically expressed in E. coli expression systems with an N-terminal His-tag to facilitate purification. The commercially available recombinant protein (catalog number RFL15732AF) is produced in this manner and supplied as a lyophilized powder . The His-tag enables efficient purification using affinity chromatography and allows for easy detection in experimental settings .
The amino acid sequence of FH9 includes specific motifs that contribute to its functional properties. A partial sequence includes: "STVTLSRRLLYDYESPLPLPLSPISPPFFPLESSPPSPPPPLPPTPPTTFAVFPTFPANISALVLPRSSKPHHTSPTLLLPALSAVLVIATVIGLALFLYGRHRGQTRHLKNS" . This sequence contains characteristic features that may contribute to its function in actin regulation and potential membrane localization.
Group Ie formins in Arabidopsis, including AtFH4 and AtFH8, have been shown to localize to specific domains at the cell membrane, particularly at the borders between adjoining cells . This specific localization pattern suggests that these formins function in regulating actin polymerization at distinct membrane sites, potentially contributing to cell-cell communication or targeted growth processes.
The subcellular localization of AtFH4 and AtFH8 has been observed using indirect immunofluorescence and GFP fusion constructs, respectively. These studies revealed that aberrant expression of AtFH8 resulted in the inhibition of root hair elongation, demonstrating the importance of proper formin function in cell expansion processes . Given the structural similarity between FH9 and these well-characterized formins, FH9 may exhibit similar localization patterns and functions in cell expansion.
Formins interact with various proteins to regulate actin dynamics. One of the key interacting partners is profilin, an actin-binding protein that promotes actin polymerization by facilitating the addition of actin monomers to growing filaments. Studies on AtFH4 have demonstrated isoform-specific interactions with profilin both in vitro and in vivo, suggesting precise functional specialization .
Based on structural similarity, FH9 likely interacts with profilin and potentially other actin-binding proteins to coordinate actin dynamics in specific cellular contexts. These interactions may enable FH9 to respond to cellular signals and participate in regulated actin remodeling during various developmental and environmental responses.
Studies on other Arabidopsis formins have demonstrated their importance in various aspects of plant development. For instance, aberrant expression of AtFH8 has been shown to inhibit root hair elongation, indicating its role in cell expansion processes . Given the structural similarity between FH9 and other characterized formins, FH9 may play comparable roles in regulating cell growth and morphogenesis.
The functional properties of AtFH4 and AtFH8, members of the group Ie clade of Arabidopsis formin homologues, provide clues about the potential functions of FH9. AtFH4 affects actin dynamics in vitro and interacts with profilin isoforms in a specific manner . These proteins localize to specific cell membrane domains and influence cell expansion processes, as evidenced by the inhibition of root hair elongation upon aberrant expression of AtFH8 .
| Formin Protein | Sequence Identity with FH9 | Known Functions | Subcellular Localization |
|---|---|---|---|
| AtFH4 (At1g24150) | 67.4% | Affects actin dynamics, interacts with profilin | Cell membrane at borders between cells |
| AFH1 (At3g25500) | 36.6% | Actin nucleation, pollen tube growth regulation | Not specified in search results |
| AtFH6 (At5g67470) | 33.2% | Involved in nematode infection processes | Not specified in search results |
| AtFH8 | Not specified | Inhibits root hair elongation when aberrantly expressed | Cell membrane zones |
Recombinant FH9 protein serves as a valuable tool for studying actin cytoskeleton dynamics in plants. The availability of purified FH9 allows researchers to investigate its biochemical properties, including its effects on actin polymerization, interactions with other proteins, and responses to various signals. Such studies contribute to our understanding of cytoskeletal regulation in plants and its implications for plant growth and development.
The recombinant protein can be used in various experimental approaches, including in vitro actin polymerization assays, protein-protein interaction studies, and structural analyses. These investigations help elucidate the molecular mechanisms underlying FH9 function and its contributions to cellular processes.
Understanding the functions of plant formins like FH9 may have implications for biotechnological applications. The actin cytoskeleton plays crucial roles in plant responses to environmental stresses, pathogen defense, and growth regulation. By manipulating formin expression or activity, it may be possible to enhance plant resilience to stresses or improve agronomically important traits.
Additionally, insights into how formins regulate actin dynamics can inform the development of novel cytoskeleton-targeting compounds or strategies for modifying plant architecture. Such approaches could have applications in agriculture, horticulture, and bioenergy production.
Formin-like protein 9 (FH9) in Arabidopsis thaliana belongs to the formin family of proteins that play crucial roles in cytoskeletal organization. While specific FH9 functions are still being elucidated, research on other Arabidopsis formins, such as Class II formin FH13, demonstrates their involvement in modulating pollen tube growth and actin cytoskeleton organization. Class II formins are now understood as modulators of cellular processes rather than simply components of growth machinery. By extrapolation, FH9 likely contributes to cytoskeletal dynamics in specific tissues or developmental stages of Arabidopsis, potentially influencing cell morphogenesis, growth directionality, or intracellular trafficking .
Formins represent a distinct class of actin-binding proteins that nucleate and elongate actin filaments. Unlike other cytoskeletal regulators, formins in Arabidopsis directly coordinate both actin remodeling and exocytosis at growing cell tips, particularly in tip-growing cells. For example, research on FH13 and other formins shows they contribute to organization of the actin fringe in pollen tubes, with their loss leading to structural defects in subapical actin. This dual functionality distinguishes formins from other regulators that might influence only bundling, severing, or capping of existing filaments. The specialized domains in formins allow them to interact with both the plasma membrane and actin monomers simultaneously, creating a unique bridge between the cell's structural and signaling systems .
Based on successful approaches with similar proteins, several expression systems are viable for recombinant Arabidopsis FH9 production:
Arabidopsis seed-based expression system: Using seed-specific promoters like β-PHASEOLIN (PPHAS) to drive expression can yield high protein accumulation (5-10% of total soluble protein), though it may trigger unfolded protein response (UPR) in the endoplasmic reticulum .
Arabidopsis oil body expression system: Similar to the technique used for rhFGF9, where the recombinant protein is expressed as a fusion with oleosin in oil bodies via the floral dip transformation method. This system allows for relatively simple protein purification through oil body isolation .
Bacterial expression systems: While not detailed in the search results, E. coli systems are commonly used for recombinant plant protein production, particularly when functional analyses rather than post-translational modifications are the primary goal.
The choice depends on research requirements, with plant-based systems offering advantages for proteins requiring plant-specific post-translational modifications.
Experimental design for analyzing FH9's influence on actin dynamics should incorporate multiple complementary approaches:
Genetic manipulation strategies:
Generate knockout/knockdown lines using T-DNA insertion or CRISPR-Cas9
Create overexpression lines using native or constitutive promoters
Develop fluorescent protein-tagged FH9 transgenic lines under native promoter control
Cytoskeletal visualization techniques:
Employ live-cell imaging with fluorescent actin markers (e.g., Lifeact-GFP) in wild-type versus mutant backgrounds
Use fixed-cell visualization with phalloidin staining for higher resolution imaging
Implement super-resolution microscopy for detailed actin structure analysis
Functional assays:
Analyze growth parameters of tip-growing cells (pollen tubes, root hairs)
Assess cellular responses to actin-disrupting drugs in wild-type versus mutant lines
Examine protein-protein interactions through co-immunoprecipitation to identify FH9 binding partners
This multi-faceted approach parallels successful strategies used with other formins like FH13, where expression of fluorescent protein-tagged FH13 under its native promoter revealed non-homogeneous distribution in pollen tube cytoplasm, providing insights into its function .
Based on phenotypes observed with other Arabidopsis formins, FH9 manipulation may produce the following cellular effects:
| Genetic Manipulation | Expected Cellular Phenotypes | Molecular Consequences |
|---|---|---|
| FH9 Knockout/Knockdown | - Potential alterations in actin organization - Possible changes in cell elongation rate - Potential impacts on directional growth | - Disruption of normal actin dynamics - Altered vesicle trafficking - Potential compensatory upregulation of other formins |
| FH9 Overexpression | - Excessive actin cable formation - Potential cell tip swelling - Possible loss of cell polarity | - Imbalance in actin dynamics - Disruption of the fine actin fringe - Altered vesicle targeting |
This prediction is supported by observations of other formin mutants, where Class II formin FH13 knockout resulted in stimulation of pollen tube growth while overexpression inhibited elongation, suggesting a role in controlling or limiting cell growth . Similarly, overexpression of Arabidopsis FH1 in tobacco pollen tubes caused growth arrest and tip swelling due to disrupted actin dynamics .
While specific FH9 interactions await experimental verification, research on related formins suggests probable interaction networks:
Actin-related interactions:
Direct binding to G-actin for nucleation and elongation activities
Potential competitive or cooperative interactions with profilins (critical for formin function)
Possible regulation by small GTPases that control formin activation
Membrane associations:
Interactions with phospholipids for localization to specific membrane domains
Potential associations with exocytotic vesicles, similar to lily formin LlFH1 localization to vesicles at the leading edge of the actin fringe
Signaling components:
Regulatory interactions with kinases that may modulate formin activity through phosphorylation
Possible calcium-dependent regulation, particularly important in tip-growing cells
Understanding these interactions is crucial, as research has shown that the balance between profilin and formin contributes to determination of growth rates in structures like pollen tubes .
For recombinant FH9 expression in Arabidopsis, a comprehensive protocol would include:
Vector construction:
Clone the full-length FH9 cDNA into an appropriate entry vector (e.g., pENTR/D-TOPO)
Recombine into a destination vector containing a seed-specific promoter (e.g., β-PHASEOLIN) or tissue-specific promoter
Add epitope tags (FLAG, HA) or fluorescent protein fusions for detection and localization studies
Include appropriate selection markers (e.g., glufosinate resistance)
Transformation procedure:
Use Agrobacterium-mediated transformation via the floral dip method
Select primary transformants on appropriate antibiotics/herbicides
Advance to homozygous T3 or T4 generation for stable expression
Expression verification:
Confirm transgene presence by PCR and expression by RT-PCR
Verify protein production using SDS-PAGE and Western blotting with tag-specific antibodies
Quantify expression levels relative to total soluble protein
This approach builds on successful methods used for other recombinant proteins in Arabidopsis, such as the expression of oleosin-rhFGF9 fusion proteins and antibody fragments that achieved expression levels of 5-10% of total soluble protein .
Assessing recombinant FH9 functional activity requires multiple complementary approaches:
In vitro biochemical assays:
Actin polymerization assays measuring nucleation and elongation rates
Pyrene-actin assays to quantify polymerization kinetics
Microscopy-based assays visualizing filament formation
Cellular assays:
Binding partner identification:
Co-immunoprecipitation followed by mass spectrometry (IP-MS) to identify interacting proteins
Yeast two-hybrid screens for protein-protein interactions
Bimolecular fluorescence complementation (BiFC) to verify interactions in planta
When evaluating functional activity, it's essential to include appropriate controls, such as wild-type plants and established formin mutants, to provide reference points for observed phenotypes and activities.
Effective purification of recombinant FH9 from Arabidopsis tissues depends on the expression system and protein fusion design:
Oil body-based purification (if using oleosin fusion strategy):
Affinity chromatography (for tagged proteins):
Size exclusion and ion exchange chromatography:
As secondary purification steps to increase purity
Separate based on molecular size or charge properties
Combine with affinity methods for highest purity
Purification yield and protein activity should be monitored at each step using SDS-PAGE, Western blotting, and functional assays to ensure the integrity of the recombinant protein.
Identifying and confirming FH9 mutants through mapping-by-sequencing involves a systematic approach:
Mutant generation and screening:
Create a mutagenized population using EMS or other mutagens
Screen for phenotypes potentially related to cytoskeletal defects
Backcross mutants to wild-type or mapping parents
Mapping-by-sequencing procedure:
Select mutant plants from a segregating population based on phenotype
Extract DNA from a bulk of mutant individuals (30-50 plants)
Perform whole-genome sequencing at appropriate coverage (30-40x)
Analyze data using bioinformatics pipelines to identify causal mutations
Mutation confirmation:
Verify mutations through Sanger sequencing
Perform complementation tests with known alleles or transgenic complementation
Analyze multiple independent alleles when possible
This approach follows established mapping-by-sequencing protocols for Arabidopsis that have successfully identified causal mutations in various genetic screens .
The most informative phenotypic analyses for understanding FH9 function include:
Phenotypic analyses should compare multiple genetic backgrounds (wild-type, knockout, knockdown, overexpression) under various environmental conditions to comprehensively understand FH9's function, similar to approaches used for characterizing FH13's role in pollen tube growth .
Visualizing FH9 localization and dynamics in living cells requires sophisticated imaging approaches:
Fluorescent protein fusion design:
Create N- and C-terminal fluorescent protein fusions (GFP, mCherry, etc.)
Express under native promoter to maintain physiological expression patterns
Validate functionality of fusion proteins through complementation tests
Advanced microscopy techniques:
Confocal laser scanning microscopy for high-resolution localization
Spinning disk confocal microscopy for rapid time-lapse imaging
Super-resolution techniques (STED, PALM, SIM) for detailed structural analysis
FRAP (Fluorescence Recovery After Photobleaching) to measure protein dynamics
Co-visualization approaches:
Simultaneous imaging with actin markers (Lifeact, mTalin)
Dual-color imaging with vesicle or membrane markers
Multi-color imaging with other cytoskeletal components
This methodological approach parallels successful visualization strategies for other formins, such as the non-homogeneous distribution of fluorescent protein-tagged FH13 in pollen tube cytoplasm that provided insights into its cellular function .
When comparing FH9 with other formin family members, several key considerations are essential:
Structural and sequence analysis:
Detailed comparison of functional domains (FH1, FH2, etc.)
Analysis of conserved versus divergent motifs
Evaluation of potential regulatory regions
Expression pattern differences:
Tissue-specific and developmental expression profiles
Response to environmental or hormonal stimuli
Co-expression analysis with potential interacting partners
Functional redundancy assessment:
Generation and analysis of higher-order mutants
Complementation tests between different formin family members
Cross-species complementation studies
Evolutionary context:
Phylogenetic analysis across plant species
Comparison with animal formins to identify plant-specific features
Analysis of selection pressure on different formin domains
When conducting comparative analyses, it's important to recognize the distinct functional roles of Class I versus Class II formins, as research has shown their differentiated contributions to processes like pollen tube growth .
Addressing unfolded protein response (UPR) during recombinant FH9 expression requires strategic approaches:
Monitoring UPR activation:
Analyze transcriptome changes using microarrays or RNA-seq
Look for upregulation of UPR marker genes related to protein folding, glycosylation, translocation, and degradation
Quantify expression of specific UPR components through qPCR
Mitigation strategies:
Optimize codon usage for efficient translation
Co-express molecular chaperones to assist protein folding
Consider temporal regulation of expression to prevent overwhelming the ER
Expression system adjustments:
Test different promoters with varying expression strengths
Explore alternative subcellular targeting (cytosol, chloroplast)
Evaluate different plant tissues for expression (seeds vs. leaves)
Robust FH9 functional studies require comprehensive controls:
Genetic controls:
Wild-type plants (same ecotype as mutants)
Multiple independent transgenic/mutant lines
Complementation lines restoring FH9 function in mutant background
Empty vector controls for transformation effects
Protein expression controls:
Non-functional FH9 variants (domain mutations)
Appropriate tags-only controls for fusion proteins
Expression level verification across experimental lines
Assay-specific controls:
Positive controls using known actin-modulating proteins
Negative controls excluding essential components
Dose-response controls for pharmacological treatments
Time-course controls for dynamic processes
Technical controls:
Biological and technical replicates
Randomization and blinding where appropriate
Internal standards for quantitative measurements
Implementing these controls ensures that observed phenotypes can be confidently attributed to FH9 function rather than experimental artifacts or secondary effects.