Recombinant Arabidopsis thaliana Gamma-secretase subunit APH1-like (At2g31440)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Functional Role

Recombinant Arabidopsis thaliana Gamma-secretase subunit APH1-like (At2g31440) is a 250-amino acid protein encoded by the At2g31440 gene. It functions as a critical component of the gamma-secretase complex, a multisubunit protease involved in intramembrane cleavage of transmembrane substrates, including amyloid precursor protein (APP) . This subunit stabilizes the complex and facilitates substrate recognition and processing .

Key Features:

  • UniProt ID: Q8L9G7 .

  • Gene Aliases: APH-1, T28P16.7 .

  • Domain: Contains six transmembrane domains (TMDs), with conserved residues critical for γ-secretase activity .

Role in Gamma-Secretase Activation

The APH1 subunit interacts with presenilin (PS1), nicastrin (NCT), and PEN2 to form the active γ-secretase complex. Structural studies reveal:

  • Leu30 and Thr164 Mutations: Double mutations (L30F/T164A) enhance Aβ production by altering PS1 conformation, increasing ε-cleavage activity .

  • Hydrogen Bond Networks: Thr164 forms a hydrogen bond with PS1 Tyr466; its disruption (e.g., T164A) increases catalytic flexibility .

Table 1: Impact of Aph1 Mutations on γ-Secretase Activity

MutationAβ ProductionPS1 InteractionComplex Stability
Wild-Type (WT)BaselineStableHigh
L30F/T164A↑ 3-foldAlteredUnchanged
T164A↑ 2-foldDisruptedUnchanged

Enhanced Aβ Production

  • Mechanism: The L30F/T164A mutant increases Aβ38, Aβ40, Aβ42, and Aβ43 levels without altering species ratios, suggesting broader catalytic activation rather than substrate preference .

  • Structural Basis: Cryo-EM data show Leu30 near PS1 TMD1, influencing piston-like movements critical for substrate docking .

Complex Assembly

  • Co-Immunoprecipitation: Aph1 mutants retain binding to PS1 and NCT, confirming that activity enhancement does not depend on complex stability .

Applications in Research

  • In Vitro Assays: Used to study γ-secretase kinetics, inhibitor screening, and Aβ pathology models .

  • Protein Interaction Studies: Employed in yeast two-hybrid and co-IP experiments to map γ-secretase subunit interfaces .

Future Directions

  • Therapeutic Targeting: Aph1 mutations could inform γ-secretase modulators for Alzheimer’s disease, balancing Aβ reduction and Notch signaling safety .

  • Structural Dynamics: Further cryo-EM studies are needed to resolve conformational changes induced by APH1 variants .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we understand you may have specific requirements. Please indicate your preferred format in the order notes, and we will accommodate your needs whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time estimates.
Note: Our proteins are typically shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it for your order.
Synonyms
At2g31440; T28P16.7; Gamma-secretase subunit APH1-like
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-250
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At2g31440
Target Protein Sequence
MTVAAGIGYALVALGPSLSLFVSVISRKPFLILTVLSSTLLWLVSLIILSGLWRPFLPLK ANVWWPYALLVITSVCFQEGLRFLFWKVYKRLEDVLDSFADRISRPRLFLTDKLQIALAG GLGHGVAHAVFFCLSLLTPAFGPATFYVERCSKVPFFLISAIIALAFVTIHTFSMVIAFE GYAKGNKVDQIIVPVIHLTAGMLTLVNFASEGCVIGVPLLYLVASLTLVHCGKMVWQRLL ESRNQSSASR
Uniprot No.

Target Background

Function
This protein is likely a subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral proteins, such as Notch receptors.
Gene References Into Functions
  1. All gamma-secretase subunits: PS1/PS2, APH-1, PEN-2, and NCT colocalize and interact with each other in Arabidopsis thaliana protoplasts. [AtAPH-1] PMID: 24723404
Database Links

KEGG: ath:AT2G31440

STRING: 3702.AT2G31440.1

UniGene: At.20784

Protein Families
APH-1 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Arabidopsis thaliana Gamma-secretase subunit APH1-like protein?

Arabidopsis thaliana Gamma-secretase subunit APH1-like (At2g31440) is a component of the gamma-secretase complex in plants. This protein is part of a multisubunit proteolytic complex that, in mammals, is responsible for the final step in the formation of beta-amyloid peptides associated with Alzheimer's disease. The full-length protein consists of 250 amino acids and is encoded by the At2g31440 gene located on chromosome 2. The gamma-secretase complex in both plants and animals contains four core proteins: presenilin, nicastrin, Aph-1, and Pen-2, with all four components required for proteolytic activity of the complex .

Why do plants have gamma-secretase components despite lacking nervous systems?

The presence of gamma-secretase components in plants despite their lack of a nervous system represents an evolutionary puzzle. The gamma-secretase complex in humans is involved in the formation of beta-amyloid peptides related to Alzheimer's disease. Surprisingly, all four components of the complex (presenilin, nicastrin, Aph-1, and Pen-2) co-evolved in plants, suggesting a conserved function that predates the divergence of plants and animals .

This conservation indicates that the gamma-secretase complex likely performs fundamental cellular functions unrelated to neurological processes. Potential roles may include regulated intramembrane proteolysis of plant-specific substrates, involvement in developmental signaling pathways, or cellular homeostasis mechanisms. The function of plant gamma-secretase remains a significant research question, making it a fascinating subject for comparative biology and evolutionary studies .

How should recombinant Arabidopsis APH1-like protein be handled for optimal stability?

Proper handling of recombinant Arabidopsis thaliana Gamma-secretase subunit APH1-like protein is crucial for maintaining its stability and functionality during experimental procedures. Follow these methodological guidelines:

Storage ParameterRecommended ConditionNotes
Long-term Storage-20°C to -80°C-80°C preferred for extended storage
Working Storage4°CStable for up to one week
Buffer CompositionTris/PBS-based, pH 8.0Contains 6% Trehalose for stability
Glycerol Content5-50% final concentration50% typically recommended
ReconstitutionDeionized sterile waterConcentration: 0.1-1.0 mg/mL
AliquotingMultiple small volumesMinimizes freeze-thaw cycles

Before opening, briefly centrifuge the vial to bring contents to the bottom. After reconstitution, divide the protein into working aliquots to prevent repeated freeze-thaw cycles, which can significantly degrade protein quality. For experiments requiring active protein, minimize the time between thawing and use .

What expression systems are most effective for producing Arabidopsis gamma-secretase components?

Selection of an appropriate expression system is critical for successful production of functional Arabidopsis gamma-secretase components:

coli Expression System

This system is commonly used for producing individual components like the APH1-like protein. The recombinant full-length protein can be expressed with an N-terminal His tag to facilitate purification. While this system offers high yield and cost-effectiveness, it may not provide the post-translational modifications necessary for full functionality .

Insect Cell/Baculovirus System

The baculovirus expression system in Sf9 insect cells represents a superior approach for studying the complete gamma-secretase complex. This system allows for simultaneous expression of all four gamma-secretase components (presenilin, nicastrin, Aph-1, and Pen-2) from a single plasmid, ensuring 100% co-infection by all components. This strategy provides a powerful tool for studying the putative proteolytic function of the complete Arabidopsis gamma-secretase complex in vitro .

How can researchers design blocking experiments to study Arabidopsis gamma-secretase function?

Effective experimental design using blocking techniques can significantly enhance the statistical power and reliability of studies investigating Arabidopsis gamma-secretase function:

Rationale for Blocking in Gamma-Secretase Research

Blocking groups similar experimental units together, reducing variability within each block and making treatment effects easier to detect. This approach is particularly valuable when studying complex proteins like gamma-secretase where multiple factors can influence experimental outcomes .

Implementation Strategies

  • Genetic Background Blocking: Group experiments using the same Arabidopsis ecotype or genetic background to minimize variation unrelated to the gamma-secretase components.

  • Environmental Condition Blocking: Control for growth conditions by blocking experiments conducted under the same light, temperature, and humidity parameters.

  • Temporal Blocking: Group experiments performed within the same timeframe to account for seasonal or circadian variations.

  • Technical Factor Blocking: Account for variables like reagent batches, equipment differences, or operator techniques.

Analytical Considerations

When analyzing data from blocked experimental designs:

  • Include block as a factor in statistical models

  • Use mixed-effects models when appropriate

  • Calculate the reduction in experimental error achieved through blocking

  • Report block effects transparently in publications

How can the putative proteolytic function of Arabidopsis gamma-secretase be investigated?

Investigating the proteolytic function of Arabidopsis gamma-secretase requires a multifaceted approach combining in vitro biochemical assays with in vivo functional studies:

In Vitro Reconstitution System

The most direct approach involves reconstituting the complete gamma-secretase complex from recombinant components. By simultaneously expressing all four proteins (presenilin, nicastrin, Aph-1, and Pen-2) in a system like Sf9 insect cells, researchers can obtain an assembled complex for biochemical characterization. This system provides a controlled environment to test putative proteolytic activity against candidate substrates .

Substrate Identification Strategy

ApproachMethodologyAdvantages
Candidate-BasedTest known mammalian substrates with Arabidopsis complexLeverages evolutionary conservation
ProteomicsCompare membrane proteome in wild-type vs. mutant plantsUnbiased discovery of natural substrates
Synthetic BiologyEngineer artificial substrates with predicted cleavage sitesControlled testing of specificity
Yeast Two-HybridScreen for proteins interacting with gamma-secretase componentsIdentifies potential regulatory partners

Activity Assays

Proteolytic activity can be measured using fluorogenic peptide substrates, with cleavage monitored through techniques like FRET (Förster Resonance Energy Transfer). Alternative approaches include mass spectrometry to detect specific cleavage products or Western blotting to observe substrate processing. These methodologies can help establish whether the plant gamma-secretase functions as a bona fide protease and characterize its substrate specificity .

What can bioinformatic approaches reveal about the evolutionary conservation of APH1-like proteins?

Bioinformatic analyses provide valuable insights into the evolutionary history and functional conservation of gamma-secretase components across species:

Sequence Conservation Analysis

Multiple sequence alignment of APH1-like proteins from diverse plant species can reveal highly conserved domains likely essential for function. Comparison with mammalian APH1 proteins highlights regions that maintained conservation across kingdoms versus those that diverged, suggesting kingdom-specific adaptations.

Structural Prediction

While crystal structures of plant gamma-secretase components are not yet available, homology modeling based on mammalian counterparts can predict structural features. These models can identify conserved transmembrane domains, potential interaction surfaces with other complex components, and putative substrate-binding regions.

What experimental controls are essential when studying Arabidopsis gamma-secretase function?

Rigorous experimental controls are crucial for reliable interpretation of gamma-secretase research findings:

Genetic Controls

  • Multiple Allelic Variants: Use several independent mutant alleles for each gamma-secretase component to confirm phenotype specificity.

  • Complementation Lines: Reintroduce wild-type genes into mutant backgrounds to verify that observed phenotypes are directly caused by the mutation.

  • Catalytic Mutants: Generate variants with mutations in catalytic residues to distinguish between structural and enzymatic functions.

Biochemical Controls

  • Protein Expression Verification: Confirm expression levels of all complex components using Western blotting or mass spectrometry.

  • Complex Assembly Validation: Verify proper complex formation through co-immunoprecipitation or native gel electrophoresis.

  • Inhibitor Specificity: Test multiple gamma-secretase inhibitors with different chemical structures to confirm target specificity.

Experimental Design Controls

  • Randomization: Randomly assign plants to treatment groups to minimize bias.

  • Blinding: Conduct phenotypic analyses without knowledge of genotype to prevent observer bias.

  • Appropriate Statistical Methods: Use statistical approaches that account for the experimental design and data distribution.

Implementation of these controls ensures that observed effects can be confidently attributed to gamma-secretase function rather than to experimental artifacts or secondary effects .

How does Arabidopsis gamma-secretase compare functionally to its mammalian counterpart?

Despite evolutionary conservation of the four core components (presenilin, nicastrin, Aph-1, and Pen-2), significant functional differences likely exist between plant and mammalian gamma-secretase complexes:

Differences

  • Substrate specificity: Mammalian gamma-secretase processes proteins like APP and Notch, while plant substrates remain unknown

  • Cellular localization: May differ due to plant-specific membrane compartmentalization

  • Regulatory mechanisms: Likely evolved differently due to distinct cellular signaling networks

What is known about post-translational modifications of Arabidopsis APH1-like protein?

Current knowledge about post-translational modifications (PTMs) of Arabidopsis APH1-like protein is limited, but several potential modifications can be predicted based on sequence analysis and comparison with mammalian counterparts:

Potential Modifications

Modification TypePrediction SitesFunctional Significance
PhosphorylationSerine/Threonine residues in cytoplasmic domainsRegulation of complex assembly or activity
GlycosylationAsparagine residues in luminal domainsProtein stability and trafficking
PalmitoylationCysteine residues near transmembrane domainsMembrane association and localization
UbiquitinationLysine residues in cytoplasmic regionsProtein turnover and quality control

Analytical Approaches

To experimentally identify and characterize PTMs in Arabidopsis APH1-like protein, researchers can employ:

  • Mass spectrometry-based proteomics

  • Site-directed mutagenesis of predicted modification sites

  • Specific antibodies against known modifications

  • Chemical inhibitors of PTM-catalyzing enzymes

Functional Implications

Understanding the PTM profile of Arabidopsis APH1-like protein could provide insights into:

  • Regulation of gamma-secretase complex assembly

  • Compartment-specific localization within plant cells

  • Substrate recognition mechanisms

  • Integration with plant-specific signaling pathways

This represents an important area for future research that could reveal fundamental aspects of gamma-secretase function in plants .

What technical challenges exist in determining the structure of plant gamma-secretase complex?

Structural determination of the plant gamma-secretase complex presents significant technical challenges that researchers must overcome:

Expression and Purification Obstacles

  • Membrane protein nature makes expression and purification difficult

  • Need for co-expression of all four components in correct stoichiometry

  • Requirement for detergent solubilization while maintaining complex integrity

  • Low natural abundance necessitates recombinant expression systems

Structural Analysis Limitations

  • Large size and flexibility of the complex challenges crystallization

  • Transmembrane domains create additional difficulties for crystallography

  • Heterogeneity in post-translational modifications or complex assembly

  • Requirement for stabilizing conditions that don't disrupt native structure

Methodological Solutions

Recent advances in structural biology techniques offer promising approaches:

  • Cryo-electron microscopy (cryo-EM) can determine structures without crystallization

  • Nanodiscs or amphipols provide membrane-mimetic environments

  • Chemical crosslinking can stabilize the complex for analysis

  • Advanced expression systems like baculovirus/Sf9 enable coordinated production of all components

Strategic Approach

A comprehensive strategy might begin with individual component structures before tackling the entire complex. Alternatively, examining the complex with bound inhibitors or substrate analogs may stabilize it for structural studies. Comparative modeling based on mammalian structures provides a starting point, but plant-specific features will require direct structural determination .

What factors might affect the activity of recombinant Arabidopsis gamma-secretase in experimental settings?

Multiple factors can influence the activity of recombinant Arabidopsis gamma-secretase, requiring careful optimization for reliable experimental results:

Expression System Variables

  • Host cell type (bacterial, insect, plant)

  • Expression conditions (temperature, induction parameters)

  • Co-expression efficiency of all four components

  • Presence of appropriate chaperones for correct folding

Purification and Storage Factors

  • Detergent selection for membrane protein extraction

  • Buffer composition (pH, salt concentration, glycerol content)

  • Storage temperature and freeze-thaw cycles

  • Protein concentration and potential aggregation

Assay Conditions

  • Lipid environment (native membranes vs. artificial systems)

  • Substrate selection and concentration

  • Presence of cofactors or activators

  • Incubation time and temperature

Troubleshooting Approach

When activity is lower than expected, systematically test:

  • Complex integrity via size-exclusion chromatography or native PAGE

  • Component stoichiometry through quantitative Western blotting

  • Membrane incorporation using flotation assays

  • Alternative substrates if specificity differs from mammalian counterparts

This methodical approach can help identify and address factors limiting gamma-secretase activity in experimental settings .

How can researchers distinguish between direct and indirect effects in gamma-secretase mutant phenotypes?

Distinguishing between direct and indirect effects in gamma-secretase mutant phenotypes requires rigorous experimental design and appropriate controls:

Genetic Strategies

  • Allelic Series Analysis: Compare phenotypes across multiple independent mutant alleles of varying severity.

  • Tissue-Specific Complementation: Restore gamma-secretase function in specific tissues to determine where activity is required.

  • Temporal Control: Use inducible expression systems to determine when gamma-secretase activity is necessary.

  • Separation-of-Function Mutations: Create variants that affect specific functions while preserving others.

Biochemical Validation

  • Substrate Processing: Demonstrate direct biochemical consequences by measuring substrate accumulation or product reduction.

  • Epistasis Analysis: Position gamma-secretase within signaling pathways through double-mutant analysis.

  • Catalytic Dead Controls: Compare phenotypes between null mutations and catalytically inactive variants.

Statistical Considerations

  • Effect Size Quantification: Measure the magnitude of phenotypic effects to distinguish primary from secondary consequences.

  • Correlation Analysis: Determine whether phenotype severity correlates with biochemical markers of gamma-secretase activity.

  • Multiple Test Correction: Apply appropriate statistical methods when analyzing multiple phenotypes.

These approaches help establish causality between gamma-secretase activity and observed phenotypes, separating direct effects from secondary consequences of disrupting this multifunctional complex .

Experimental Design Considerations

  • Blocked Designs: When using blocking to reduce experimental variability, include block effects in statistical models.

  • Nested Designs: Account for hierarchical data structures (e.g., plants within pots, samples within plants).

  • Factorial Experiments: Use appropriate models for multifactor experiments examining interactions between gamma-secretase mutations and environmental conditions.

Statistical Test Selection

Data TypeAppropriate TestsConsiderations
Continuous MeasurementsANOVA, mixed-effects models, regressionCheck assumptions of normality and homoscedasticity
Count DataPoisson regression, negative binomial modelsHandle overdispersion appropriately
Categorical OutcomesChi-square tests, logistic regressionEnsure adequate sample sizes for each category
Time SeriesRepeated measures ANOVA, longitudinal modelsAccount for temporal autocorrelation

Advanced Statistical Approaches

  • Multiple Testing Correction: Apply methods like Bonferroni or false discovery rate when performing multiple comparisons.

  • Power Analysis: Determine appropriate sample sizes to detect biologically meaningful effects.

  • Bayesian Methods: Consider when prior information is available or when dealing with complex hierarchical data.

  • Machine Learning: Use for exploratory analysis of complex phenotypic data or identifying patterns in large datasets.

Reporting Standards

  • Clearly state statistical methods in publications

  • Report effect sizes alongside p-values

  • Include measures of variability (standard error, confidence intervals)

  • Make raw data available when possible

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.