Recombinant Arabidopsis thaliana GDT1-like protein 4 (At1g25520)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Arabidopsis thaliana GDT1-like Protein 4 (At1g25520)

Recombinant Arabidopsis thaliana GDT1-like protein 4 (At1g25520), also known as Q9C6M1, is a transmembrane protein belonging to the UPF0016 family. This protein plays critical roles in ion transport and cellular homeostasis, particularly in processes linked to calcium (Ca²⁺), manganese (Mn²⁺), and proton (H⁺) exchange. Its recombinant form is commercially available for research, enabling studies on its structural and functional properties in Arabidopsis and related organisms.

Ion Transport Mechanism

GDT1-like protein 4 functions as a Ca²⁺/H⁺ and Mn²⁺/H⁺ antiporter, mediating ion exchange across membranes. This activity is conserved across species, with homologs like yeast Gdt1p and human TMEM165 performing similar roles in Golgi-localized cation homeostasis .

Key Functions

  • Calcium Regulation:

    • Supports Ca²⁺ sequestration in Golgi compartments, indirectly influencing cytosolic Ca²⁺ levels .

    • Interacts genetically with Ca²⁺-ATPases (e.g., Pmr1p in yeast), suggesting complementary roles in Ca²⁺ tolerance .

  • Manganese Transport:

    • Mn²⁺ transport is critical for glycosylation enzymes in the Golgi, as Mn²⁺ acts as a cofactor for galactosyltransferases .

  • Proton Homeostasis:

    • Maintains organellar pH gradients by exchanging H⁺ ions with Ca²⁺ or Mn²⁺ .

Functional Studies in Model Organisms

Model OrganismKey FindingSource
Yeast (S. cerevisiae)gdt1Δ mutants show hypersensitivity to high Ca²⁺ and Mn²⁺, restored by truncated TMEM165 .
Human (H. sapiens)TMEM165 mutations cause glycosylation defects (CDG-II), linked to Mn²⁺ transport .
ArabidopsisAt1g25520 is implicated in photosynthesis and interacts with chloroplastic Ca²⁺/H⁺ exchangers .

Mechanistic Insights

  • Direct Transport Assays:
    Gdt1p expressed in Lactococcus lactis cells demonstrated H⁺ efflux in response to Ca²⁺ or Mn²⁺ gradients, confirming antiport activity .

  • Subcellular Localization:
    Homologs localize to the Golgi in yeast and plants, where they regulate cation and pH balance .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein shipments default to blue ice packs. If dry ice is required, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
We will determine the tag type during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
At1g25520; F2J7.20; GDT1-like protein 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At1g25520
Target Protein Sequence
MSSVLQGFTKSLAMTFVSEIGDKTFFAAAILAMRYPRRLVLAGCLSALIVMTILSATLGW AAPNLISRKWTHHITTLLFFGFGLWSLWDGFKEGGGGSEELAEVEAELDADLKANGKSPK DSSKREDENKKQNRAFLTQFFSPIFLKAFSINFFGEWGDKSQLATIGLAADENPFGVVLG GVVAQFLCTTAAVIGGKSLASQISERIVALSGGMLFIIFGIQSYLTSVEA
Uniprot No.

Target Background

Database Links

KEGG: ath:AT1G25520

STRING: 3702.AT1G25520.1

UniGene: At.17316

Protein Families
GDT1 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is At1g25520 and to which protein family does it belong?

At1g25520 is a protein from Arabidopsis thaliana classified as part of the Uncharacterized Protein Family 0016 (UPF0016), which has evolved into the GDT1 (GCR1 Dependent Translation Factor 1) family. The protein is specifically designated as "GDT1-like protein 4" in Arabidopsis and consists of 230 amino acids in its full-length form . The UPF0016/GDT1 family is found across multiple kingdoms including bacteria, yeast, plants, and humans, with members involved in cation transport, particularly manganese and calcium .

In Arabidopsis thaliana, there are five members of the UPF0016 family with different subcellular localizations - two proteins contain chloroplast targeting peptides, one has a targeting peptide for the secretory pathway, and two lack targeting peptides . This diversity suggests specialized roles for each family member in different cellular compartments.

What is the known or predicted function of At1g25520?

Based on homology to other UPF0016/GDT1 family members, At1g25520 is predicted to function as a cation transporter with specificity for manganese (Mn²⁺) and potentially calcium (Ca²⁺) . These proteins have been identified as transporters of cations, with additional reported functions in proton (H⁺) transport for some family members .

The yeast ortholog Gdt1p and human ortholog TMEM165 are well-characterized members involved in Golgi calcium and manganese homeostasis . Studies in yeast have demonstrated that Gdt1p plays a role in calcium homeostasis, with its deletion affecting cellular Ca²⁺ accumulation . The genetic interaction between Gdt1p and the Ca²⁺-Mn²⁺ P-type ATPase Pmr1p suggests complementary or overlapping functions in maintaining cation balance .

What is the predicted protein structure and topology of At1g25520?

The predicted protein topology of At1g25520, like other eukaryotic members of the UPF0016/GDT1 family, is characterized by two clusters of three transmembrane (TM) domains . These two clusters are oppositely oriented in the membrane and connected by an acidic loop region . This distinctive structural arrangement is highly conserved across family members.

A particularly important structural feature includes two highly conserved motifs located in the first (TM1) and fourth (TM4) transmembrane domains . These motifs are thought to play crucial roles in cation binding and transport . The conserved sequence typically follows the pattern E-φ-G-D-(R/K)-(S/T), where φ represents a hydrophobic amino acid, consistent with the protein's proposed function as a cation transporter.

What expression systems are most suitable for producing recombinant At1g25520 protein?

Several expression systems can be utilized for producing recombinant At1g25520, each with specific advantages:

  • E. coli expression systems: Creative BioMart offers recombinant full-length At1g25520 protein with His-tag produced in E. coli . This system allows for rapid production and relatively high yields, though as a membrane protein, special considerations may be needed for proper folding.

  • Plant-based expression systems: Arabidopsis seeds have proven effective for recombinant protein production due to their ability to provide a stable environment for protein accumulation . The use of seed-specific promoters like β-PHASEOLIN can drive high expression levels of recombinant proteins .

  • Enhanced expression strategies: Fusion of the 3'UTR of seed storage protein genes to the 3' ends of DNA sequences encoding recombinant proteins enables massive accumulation of recombinant proteins with preserved enzymatic activity in Arabidopsis seeds . This approach has been successfully applied to various proteins including human Interferon Lambda-3 .

When using plant-based expression systems, researchers should be aware that high-level production of recombinant proteins in Arabidopsis seeds can trigger an unfolded protein response, as observed with antibody production . This stress response involves up-regulation of genes corresponding to protein folding, glycosylation/modification, translocation, vesicle transport, and protein degradation .

What experimental approaches can effectively characterize At1g25520 transport activity?

To characterize the transport activity of At1g25520, researchers should employ multiple complementary approaches:

  • Yeast complementation assays: Express At1g25520 in yeast mutants lacking Gdt1p (gdt1Δ) to assess functional complementation under various cation stress conditions . This approach has been valuable for studying the yeast Gdt1p and Candida albicans CaGdt1p proteins .

  • In vitro transport assays: Purify recombinant At1g25520 and reconstitute it into liposomes to directly measure transport activity using radioactive tracers (⁴⁵Ca²⁺, ⁵⁴Mn²⁺) or fluorescent indicators .

  • Genetic manipulation in Arabidopsis: Generate knockout, knockdown, and overexpression lines in Arabidopsis thaliana to analyze phenotypes under various manganese and calcium conditions . The cmt1 mutant of another family member shows disturbed chloroplast development, reduced amounts of photosynthesis complexes, and reduced manganese incorporation into the oxygen-evolving complex .

  • Subcellular localization studies: Determine the precise cellular location of At1g25520 using fluorescent protein fusions, as different family members localize to different compartments (Golgi apparatus, chloroplast thylakoid membrane, chloroplast inner envelope) .

  • Elemental analysis: Compare manganese and calcium content in wild-type versus mutant plants using ICP-MS or similar techniques to assess the impact of At1g25520 on cellular cation homeostasis .

How can protein-protein interactions of At1g25520 be identified and characterized?

Understanding the interaction partners of At1g25520 is crucial for elucidating its functional network and regulatory mechanisms:

  • Co-immunoprecipitation: Express tagged versions of At1g25520 (His-tagged version is available ) in plants or heterologous systems, followed by immunoprecipitation and mass spectrometry to identify interacting proteins.

  • Yeast two-hybrid screening: While challenging for membrane proteins, specialized membrane-based yeast two-hybrid systems can be employed to screen for direct protein interactions.

  • Genetic interaction studies: Based on studies in yeast, At1g25520 might interact with P-type ATPases involved in cation transport, similar to the established interaction between Gdt1p and Pmr1p at the genetic level . Creating double mutants in Arabidopsis can reveal functional relationships.

  • In planta visualization: Techniques like bimolecular fluorescence complementation (BiFC) can be used to visualize protein interactions in their native cellular environment.

  • Comparative interactomics: The interaction between yeast Gdt1p and the Ca²⁺-Mn²⁺ P-type ATPase Pmr1p provides a template for investigating similar interactions in Arabidopsis . Double deletion studies in Candida albicans showed that CaGdt1p and CaPmr1p interact at the genetic level, affecting sensitivity to cell wall and ER stresses, calcium accumulation, and sensitivity to inhibitors of calcium-mediated signaling .

What are the critical domains and motifs in At1g25520 essential for its function?

Understanding the key structural elements of At1g25520 is crucial for elucidating its mechanism of action:

Site-directed mutagenesis of conserved residues, particularly in the TM1 and TM4 motifs, would be valuable for identifying specific amino acids critical for substrate binding, selectivity, and transport activity.

How does At1g25520 compare to its homologs in other organisms?

The UPF0016/GDT1 family has diverse members across multiple kingdoms, with functional specialization in different organisms:

  • Yeast homologs: Saccharomyces cerevisiae Gdt1p localizes to the Golgi membrane and functions in calcium and manganese homeostasis . The Candida albicans ortholog CaGdt1p has similar functions and interacts genetically with CaPmr1p .

  • Bacterial homologs: Some bacterial members like Vibrio cholerae MneA and Synechocystis MNX are important for cytosol detoxification by exporting manganese either out of the cell into the periplasmatic space or into the thylakoid lumen .

  • Other Arabidopsis homologs: PAM71, a thylakoid membrane localized manganese transporter, imports manganese into the thylakoid lumen to ensure proper oxygen-evolving complex (OEC) formation . CMT1, its closest homolog, localizes to the inner envelope of chloroplasts and imports manganese into the chloroplast stroma .

  • Functional conservation: Despite differences in localization and specific roles, all family members appear to be involved in cation transport, particularly manganese . The functional conservation across kingdoms suggests a fundamental role in cellular cation homeostasis.

Comparative studies expressing At1g25520 in yeast gdt1Δ mutants would be valuable for determining functional complementation and evolutionary conservation of transport activity.

How can At1g25520 research contribute to plant biotechnology applications?

Research on At1g25520 and related transporters has several potential biotechnology applications:

  • Recombinant protein production: Understanding the role of At1g25520 in the secretory pathway (if Golgi-localized) could inform strategies for efficient recombinant protein production in plants . The fusion of 3'UTR of seed storage protein genes to recombinant proteins enables massive accumulation in Arabidopsis seeds, which could be applied to At1g25520 production .

  • Stress tolerance engineering: If At1g25520 plays a role in manganese homeostasis, manipulating its expression might improve plant performance under manganese deficiency or toxicity conditions.

  • Metabolic engineering: Understanding the role of At1g25520 in cellular cation homeostasis could inform strategies for modifying metabolic pathways that depend on proper cation balance.

  • Molecular farming: The knowledge gained from studying At1g25520 in recombinant protein production systems could contribute to improving plant-based production of pharmaceuticals and industrial proteins . Plant seeds provide a stable environment for recombinant protein accumulation, but unfolded protein responses must be managed .

The production of recombinant proteins in plants is a promising approach due to its low cost and low risk of contamination with endotoxins or infectious agents from culture serum . Arabidopsis seeds specifically offer advantages due to the rapid growth of this plant and ease of protein production .

What challenges exist in producing functional recombinant At1g25520?

Several challenges must be addressed when producing functional recombinant At1g25520:

  • Membrane protein expression issues: As a membrane protein with multiple transmembrane domains, At1g25520 may face folding challenges in heterologous expression systems .

  • Unfolded protein response: High-level production of recombinant proteins in Arabidopsis seeds can trigger an unfolded protein response, causing a disturbance of normal cellular homeostasis . This stress response involves upregulation of genes related to protein folding, glycosylation/modification, translocation, vesicle transport, and protein degradation .

  • Functional verification: Confirming that recombinant At1g25520 retains transport activity requires specialized assays to measure cation transport.

  • Purification challenges: Membrane protein purification typically requires careful optimization of detergents and buffer conditions to maintain native structure and function.

  • Post-translational modifications: Ensuring proper post-translational modifications may require eukaryotic expression systems rather than bacterial systems.

Creative BioMart offers recombinant full-length At1g25520 with a His-tag produced in E. coli, suggesting that some of these challenges can be overcome with appropriate expression and purification strategies .

What are the key unanswered questions about At1g25520 function?

Several critical questions remain to be addressed regarding At1g25520:

  • Precise subcellular localization: Determining whether At1g25520 localizes to the Golgi (like yeast Gdt1p), chloroplasts (like PAM71 and CMT1), or another compartment is crucial for understanding its physiological role .

  • Transport specificity and mechanism: While family members transport manganese and calcium, the specific substrates, transport direction, and mechanism of At1g25520 need to be experimentally determined .

  • Physiological role: The impact of At1g25520 dysfunction on plant growth, development, and stress responses remains to be characterized through detailed phenotypic analysis of knockout mutants.

  • Interaction partners: Identifying proteins that physically or functionally interact with At1g25520 would provide insights into its integration within cellular networks .

  • Regulatory mechanisms: Understanding how At1g25520 expression and activity are regulated in response to varying manganese and calcium conditions would clarify its role in cellular homeostasis.

  • Structural basis of transport: Determining how the conserved motifs in TM1 and TM4 contribute to cation binding and transport would advance understanding of the mechanism .

Addressing these questions will require integrated approaches combining genetics, biochemistry, cell biology, and structural studies.

What emerging technologies could advance At1g25520 research?

Several cutting-edge technologies could accelerate understanding of At1g25520 function:

  • CRISPR/Cas9 genome editing: Precise modification of At1g25520 sequence, including domain-specific mutations, tagged versions, and conditional knockouts.

  • Cryo-electron microscopy: This technique has revolutionized membrane protein structural biology and could help determine the three-dimensional structure of At1g25520, particularly in different conformational states during transport.

  • Organelle-specific cation sensors: Genetically encoded fluorescent sensors for manganese and calcium targeted to specific cellular compartments could allow real-time monitoring of At1g25520 transport activity.

  • Proximity labeling proteomics: Techniques like BioID or APEX2 could identify proteins in the vicinity of At1g25520 in its native cellular environment.

  • Single-molecule imaging: Advanced microscopy techniques could potentially visualize conformational changes during transport or interactions with other proteins.

  • Advanced plant phenotyping: High-throughput phenotyping platforms could characterize subtle effects of At1g25520 mutation under various environmental conditions.

  • Artificial intelligence approaches: Machine learning algorithms could help identify patterns in large datasets, predict protein-protein interactions, or model cation transport mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.