Recombinant Arabidopsis thaliana GDT1-like protein 5 (At1g68650)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Information

ParameterValue
Gene NameAt1g68650 (Ordered Locus Name)
Protein NameGDT1-like protein 5
UniProt IDQ9SX28
Molecular Weight24,665 Da (full-length, 1–228 aa)
Expression HostEscherichia coli (recombinant production)
Purity≥85% (SDS-PAGE validated)
Storage-20°C or -80°C (Tris-based buffer with 50% glycerol)

The protein lacks an N-terminal extension, distinguishing it from other Arabidopsis UPF0016 members like PAM71, which possess chloroplast transit peptides .

UPF0016 Family Overview

The UPF0016/GDT1 family spans eukaryotes and prokaryotes, with roles in:

  • Cation transport: Ca²⁺/Mn²⁺ exchange in yeast Golgi .

  • Glycosylation: Mn²⁺ homeostasis in human Golgi (TMEM165) .

  • Photosynthesis: Mn²⁺ uptake for the water-oxidizing complex in Arabidopsis (PAM71) .

At1g68650-Specific Features

FeatureDescription
LocalizationUnknown; lacks N-terminal signal peptides (unlike PAM71) .
Functional RoleHypothetical cation transporter; no direct evidence yet.
Homology32% identity with PAM71; part of a duplicated gene pair (At1g25520) .

Experimental Utilization

  • Recombinant Production: Expressed in E. coli for structural studies or functional assays .

  • Functional Studies: Potential use in assays to test Ca²⁺/Mn²⁺ transport or interactions with Arabidopsis Ca²⁺-ATPases (e.g., PMR1) .

Unanswered Questions

  1. Subcellular Localization: Where does At1g68650 localize? Golgi, ER, or other organelles?

  2. Transport Mechanism: Does it mediate Ca²⁺/H⁺ or Mn²⁺/H⁺ exchange, similar to yeast Gdt1p ?

  3. Physiological Role: Is it involved in stress response, glycosylation, or photosynthesis?

Comparative Analysis with Related Proteins

ProteinFunctionLocalizationKey Difference
AtPAM71Mn²⁺ uptake for photosynthesisThylakoid membraneChloroplast transit peptide .
ScGdt1pCa²⁺/Mn²⁺ transport in GolgiGolgi apparatusGenetic interaction with PMR1 .
At1g68650Unknown (putative cation transport)UndeterminedNo N-terminal extension; duplicated gene .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
At1g68650; F24J5.11; GDT1-like protein 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-228
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At1g68650
Target Protein Sequence
MGSLLQGFTKSLAMTFLSEIGDKTFFAAAILAMRYPRRLVLAGCLSALIVMTILSATLGW AAPNLISRKWTHHITTFLFFGFGLWSLWDGFKEGGGSEELAEVEAELDSDLKKTNDQSKN SKIEDEQKKQKRPFLTAFFSPIFLKAFSINFFGEWGDKSQLATIGLAADENPLGVVLGGI VAQTLCTTAAVLGGKSLASQISERIVALSGGMLFIIFGIQSLLTPVDA
Uniprot No.

Target Background

Database Links

KEGG: ath:AT1G68650

STRING: 3702.AT1G68650.1

UniGene: At.66838

Protein Families
GDT1 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is At1g68650 and how is it classified within protein families?

At1g68650 encodes the GDT1-like protein 5 in Arabidopsis thaliana, belonging to the Uncharacterized Protein Family 0016 (UPF0016), also referred to as the Gcr1-dependent translation factor1 (GDT1) family. This highly conserved membrane transporter family has members in many lineages across the tree of life . The protein consists of 228 amino acids in its full-length form and is available as a recombinant protein with histidine tags for research purposes . The UPF0016/GDT1 family represents an important group of poorly studied membrane proteins that are evolutionarily conserved and typically possess one or two copies of a conserved motif with the consensus sequence E-φ-G-D-(KR)-(TS) .

What is known about the structure and topology of GDT1-like proteins?

The GDT1-like protein 5 (At1g68650) features a characteristic membrane protein topology common to the UPF0016 family. While the specific structure of At1g68650 has not been fully characterized in the provided research, related UPF0016 family members exhibit specific targeting peptides that direct their localization. For instance, ScGdt1p, HsTMEM165, and AtPML3 possess N-terminal signal peptides directing them to the Golgi membrane, while Arabidopsis PAM71 and CMT1 contain chloroplast-targeting peptide (cTP) sequences that direct these proteins to the thylakoid and inner-envelope membranes, respectively . This suggests potential membrane localization patterns for At1g68650, though specific experimental confirmation would be necessary to determine its precise cellular location.

What cellular functions have been attributed to At1g68650 and related GDT1 family proteins?

Members of the GDT1 family, including At1g68650, are primarily involved in cation homeostasis within cellular compartments. Evidence from studies on related family members indicates functions in:

  • Calcium (Ca²⁺) homeostasis: The yeast ortholog Gdt1p influences cellular Ca²⁺ accumulation, likely by modulating intraluminal Golgi cation content. The expression level of GDT1 affects the Ca²⁺ response observed after exposure of yeast cells to salt stress .

  • Manganese (Mn²⁺) transport: UPF0016 proteins like PAM71 and CMT1 in Arabidopsis have been implicated in manganese transport in the thylakoid membrane. Experiments showing that AtCMT1, HsTMEM165, and SynMNX can operate in the thylakoid membrane and substitute for PAM71 suggest that manganese transport function is an ancient feature of this family .

  • Interaction with P-type ATPases: GDT1 proteins interact with PMR1 (a Ca²⁺-Mn²⁺ P-type ATPase) at the genetic level, suggesting collaborative functions in cation transport and homeostasis .

This multifunctional nature makes At1g68650 and related proteins critical components of cellular ion regulation systems.

How does At1g68650 respond to nutrient stress conditions?

While specific data for At1g68650's response to nutrient stress is not directly presented in the search results, insights can be gained from related studies on UPF0016 family proteins. Research on iron deficiency in Arabidopsis shows that transcriptional changes occur in response to metal ion deficiency, particularly affecting genes involved in ion binding and transport . The table below shows transcriptional changes in response to iron deficiency across different time points:

Treatment (h, -Fe)DEGGene Categoryp value, corrected
022none
0.580response to light stimulus1.7e-02
carbon utilization3.6e-02
136sugar binding3.1e-02
660transporter activity7.1e-02
iron ion binding2.4e-04
response to metal ion1.3e-03
cation transport2.6e-02
2479iron ion binding3.83e-03
ion transporter activity6.83e-03
C-C lyase activity3.43e-02

This pattern of transcriptional regulation suggests that GDT1-like proteins may similarly be regulated under nutrient stress conditions, particularly those involving metal ions, though direct experimental evidence for At1g68650 would be required to confirm this hypothesis.

What expression systems are recommended for recombinant production of At1g68650?

For recombinant production of At1g68650, Escherichia coli is a commonly used expression system. Based on the available data, recombinant full-length Arabidopsis thaliana GDT1-like protein 5 (At1g68650) can be successfully expressed in E. coli with a histidine tag . This approach allows for the production of the full-length protein (spanning amino acids 1-228) for subsequent purification and functional studies.

When designing expression constructs, researchers should consider:

  • Inclusion of appropriate tags (such as polyhistidine) to facilitate purification

  • Codon optimization for the host expression system

  • Potential toxicity issues that might arise from membrane protein overexpression

  • Solubilization strategies for membrane proteins

For eukaryotic expression, alternatives like yeast systems might be considered, especially when studying interactions with other eukaryotic proteins, though specific protocols for At1g68650 expression in these systems would need to be developed based on approaches used for related proteins.

What genetic approaches can be employed to study At1g68650 function in planta?

Several genetic approaches can be employed to study At1g68650 function in Arabidopsis plants:

  • Gene replacement techniques: As demonstrated for other UPF0016 family members, the floral-dip method using Agrobacterium tumefaciens can be used for stable transformation of Arabidopsis . This allows for:

    • Complementation studies in knockout mutants

    • Expression of chimeric proteins

    • Introduction of tagged versions for localization studies

  • Construction of expression vectors: Using Gateway cloning systems (e.g., pENTR vectors and destination vectors like pB2GW7) facilitates the generation of expression constructs . For example:

    • PCR amplification of the gene with appropriate primers

    • Cloning into entry vectors

    • Recombination into destination vectors with appropriate promoters and tags

  • Selection of transformants: Transgenic plants can be selected using appropriate markers, such as BASTA resistance (glufosinate-ammonium at 100 mg L⁻¹) .

  • Verification and propagation: Homozygous lines should be established through genotyping and segregation analysis to ensure stable expression for functional studies .

These approaches provide a robust framework for investigating At1g68650 function through both loss-of-function and gain-of-function genetic strategies.

How can the subcellular localization of At1g68650 be determined experimentally?

Determining the subcellular localization of At1g68650 can be achieved through several experimental approaches:

  • Fluorescent protein fusion constructs: Creating GFP fusion constructs (similar to the approach described for other UPF0016 family members) would allow visualization of At1g68650 localization. This typically involves:

    • Cloning the At1g68650 coding sequence into vectors like pB7FWG2

    • Transformation into Arabidopsis or transient expression in Nicotiana benthamiana

    • Visualization using confocal microscopy

  • Immunolocalization: Using specific antibodies against At1g68650 or its epitope tags for immunofluorescence microscopy.

  • Subcellular fractionation: Isolating different cellular compartments (e.g., Golgi, ER, plasma membrane) and detecting the presence of At1g68650 through Western blotting.

  • Prediction and validation: Bioinformatic prediction of targeting sequences (e.g., signal peptides, chloroplast transit peptides) combined with experimental validation through truncation or mutation of these sequences.

Based on knowledge of related proteins, At1g68650 might localize to endomembrane compartments such as the Golgi apparatus (like Gdt1p and TMEM165) or to organellar membranes (like PAM71 and CMT1 in chloroplasts) , but direct experimental evidence is needed to confirm its specific localization.

What is known about protein trafficking mechanisms affecting At1g68650 distribution?

While specific trafficking mechanisms for At1g68650 are not directly described in the search results, insights can be drawn from related UPF0016 family proteins and general principles of membrane protein trafficking in plants:

  • Targeting signal recognition: Different UPF0016 family members contain specific targeting signals that direct their localization. For example, ScGdt1p, HsTMEM165, and AtPML3 have N-terminal signal peptides directing them to the Golgi membrane, while PAM71 and CMT1 have chloroplast-targeting peptide (cTP) sequences directing them to chloroplast membranes .

  • Potential involvement of clathrin-mediated trafficking: Studies on clathrin-mediated endocytosis (CME) in Arabidopsis have identified multiple trafficking components . While At1g68650 is not specifically mentioned in this context, membrane proteins are often regulated through such trafficking mechanisms.

  • Stress-induced relocalization: Cation transporters can be subject to stress-induced relocalization. For example, under Ca²⁺ stress conditions, yeast Gdt1p function affects calcium homeostasis, suggesting possible regulatory trafficking mechanisms .

Further research would be needed to determine the specific trafficking mechanisms governing At1g68650 localization and whether its distribution changes under different physiological or stress conditions.

How conserved is At1g68650 across different plant species and other organisms?

The UPF0016/GDT1 family, which includes At1g68650, is remarkably conserved across evolutionary lineages. This conservation extends from prokaryotes to eukaryotes, suggesting fundamental roles in cellular physiology . The evolutionary conservation of this family is evidenced by:

  • Presence across the tree of life: UPF0016 family members are found in numerous lineages, including bacteria, fungi, plants, and animals .

  • Functional complementation across species: Studies show that AtCMT1 (Arabidopsis), HsTMEM165 (human), and SynMNX (cyanobacteria) can functionally substitute for the Arabidopsis PAM71 protein in the thylakoid membrane, indicating conservation of fundamental transport functions .

  • Endosymbiotic origin of plant proteins: The two chloroplast-localized UPF0016 proteins in plants (CMT1 and PAM71) likely originated from the cyanobacterial endosymbiont that gave rise to chloroplasts, demonstrating the evolutionary connection between prokaryotic and eukaryotic family members .

This high degree of conservation suggests that At1g68650 likely shares functional similarities with homologs in other species, though species-specific adaptations in regulation and precise function may exist.

What evolutionary insights can be gained from comparing At1g68650 with its homologs?

Comparative analysis of At1g68650 with its homologs across species provides several evolutionary insights:

  • Ancient origin of transport function: The ability of cyanobacterial MNX to substitute for plant PAM71 suggests that the manganese transport function of UPF0016 proteins is an ancient feature of the family that predates the divergence of plants and cyanobacteria .

  • Functional diversification: While the core transport function appears conserved, UPF0016 proteins have diversified to function in different cellular compartments. In yeast and mammals, they function primarily in the Golgi, while in plants, additional members localize to chloroplast membranes .

  • Varying N-terminal extensions: Different UPF0016 family members have evolved distinct N-terminal targeting sequences that direct them to specific cellular compartments. For example, ER-localized proteins lack N-terminal extensions, Golgi-localized proteins have signal peptides, and chloroplast-localized proteins have chloroplast transit peptides .

  • Conservation of key functional motifs: The E-φ-G-D-(KR)-(TS) motif appears to be highly conserved across family members, suggesting its importance for the basic transport function .

This evolutionary perspective provides a framework for understanding At1g68650's role in the broader context of cellular cation homeostasis mechanisms that have been conserved and adapted throughout evolution.

What proteins are known to interact with At1g68650 and how can these interactions be studied?

While the search results don't specifically list proteins that interact with At1g68650, knowledge from related GDT1 family members suggests potential interaction partners and methods to study them:

  • Potential interaction partners:

    • P-type ATPases: The yeast Gdt1p interacts genetically with PMR1, a Ca²⁺-Mn²⁺ P-type ATPase . Similar interactions might exist for At1g68650 with Arabidopsis P-type ATPases.

    • Components of ion homeostasis pathways: Given its likely role in cation transport, At1g68650 may interact with other ion transporters or regulators.

  • Methods to study protein-protein interactions:

    • Yeast two-hybrid (Y2H) screening: Can identify direct protein-protein interactions in a heterologous system.

    • Co-immunoprecipitation (Co-IP): Using antibodies against At1g68650 or epitope-tagged versions to pull down interaction partners.

    • Tandem affinity purification (TAP): Similar to the approach used for identifying clathrin-interacting proteins in Arabidopsis .

    • Bimolecular fluorescence complementation (BiFC): To visualize interactions in planta.

    • Split-ubiquitin membrane yeast two-hybrid: Particularly suitable for membrane protein interactions.

  • Data analysis approaches:

    • Network mapping to visualize interaction data

    • Gene Ontology enrichment analysis to identify functional categories of interacting proteins

    • Cross-species comparison of interaction networks

These approaches would help build a comprehensive picture of At1g68650's functional context within cellular pathways.

How does At1g68650 integrate into broader cellular pathways related to ion homeostasis?

Based on functions attributed to UPF0016/GDT1 family members, At1g68650 likely integrates into broader cellular pathways in several ways:

  • Calcium homeostasis network: Like its yeast counterpart Gdt1p, At1g68650 may participate in maintaining Ca²⁺ levels in cellular compartments. This would connect it to:

    • Ca²⁺-dependent signaling pathways

    • Stress response mechanisms

    • Regulatory interactions with other Ca²⁺ transporters

  • Manganese transport system: UPF0016 proteins in plants participate in manganese transport, particularly in chloroplasts, affecting:

    • Photosystem II efficiency

    • Plant growth rate and biomass production

    • Manganese-dependent enzyme function

  • Response to metal stress: Early transcriptional studies in Arabidopsis show that metal ion stress induces changes in expression of genes related to:

    • Iron ion binding (p-value 2.4e-04)

    • Response to metal ions (p-value 1.3e-03)

    • Cation transport (p-value 2.6e-02)

This suggests that At1g68650 might be part of a coordinated response to metal ion availability, though specific expression data for At1g68650 under these conditions would be needed for confirmation.

Understanding these integration points could provide insights into potential targets for improving plant nutrient use efficiency or stress resistance.

What are the main technical challenges in studying membrane proteins like At1g68650?

Studying membrane proteins like At1g68650 presents several technical challenges that researchers should be aware of:

  • Protein expression and purification:

    • Membrane proteins often have low expression levels

    • Toxicity to host cells when overexpressed

    • Requirement for detergents or lipid environments for solubilization and stability

    • Potential for misfolding during recombinant expression

  • Structural characterization:

    • Difficulty in obtaining crystals for X-ray crystallography

    • Challenges in sample preparation for cryo-electron microscopy

    • Limited resolution of solution NMR for large membrane proteins

  • Functional assays:

    • Need for reconstitution into artificial membranes for transport studies

    • Challenges in measuring ion transport with appropriate temporal resolution

    • Difficulty distinguishing direct vs. indirect effects in cellular assays

  • Localization studies:

    • Potential artifacts from overexpression of tagged proteins

    • Resolution limitations in distinguishing between closely positioned membranes

    • Challenges in preserving native localization during sample preparation

Solutions to these challenges include using optimized expression systems (e.g., E. coli strains designed for membrane protein expression), employing a variety of complementary techniques (genetic, biochemical, and biophysical), and developing specialized assays for monitoring ion transport activities.

How can contradictory results in At1g68650 research be reconciled through improved experimental design?

When encountering contradictory results in At1g68650 research, several strategies can help reconcile discrepancies:

  • Standardization of experimental conditions:

    • Use consistent growth conditions for plants (light, temperature, media composition)

    • Standardize protein expression and purification protocols

    • Document detailed methodological parameters to enable proper replication

  • Multiple methodological approaches:

    • Combine in vitro biochemical assays with in vivo functional studies

    • Use both overexpression and knockout/knockdown approaches

    • Employ complementary techniques to measure the same parameter (e.g., different ion transport assays)

  • Control experiments:

    • Include appropriate positive and negative controls

    • Use well-characterized mutants as reference points

    • Perform rescue experiments to confirm specificity of observed phenotypes

  • Statistical rigor:

    • Ensure adequate sample sizes

    • Apply appropriate statistical tests

    • Consider biological vs. technical replication

  • Cross-validation across species:

    • Test whether observed functions are conserved in homologs from other species

    • Use heterologous expression systems to isolate specific functions

  • Data sharing and meta-analysis:

    • Make raw data available for reanalysis

    • Consider systematic reviews of published studies

    • Use statistical methods to reconcile contradictory findings across studies

By applying these principles, researchers can develop more robust experimental designs that help resolve contradictions and build a more consistent understanding of At1g68650 function.

How might understanding At1g68650 function contribute to improving plant stress tolerance?

Understanding the function of At1g68650 could contribute to improving plant stress tolerance in several ways:

  • Enhanced mineral nutrient efficiency: If At1g68650 functions in manganese transport similar to other UPF0016 family members, manipulating its expression or activity could improve:

    • Photosystem II efficiency under limiting manganese conditions

    • Plant growth and biomass production in manganese-deficient soils

    • Nutrient use efficiency in agricultural settings

  • Calcium homeostasis and stress signaling: Based on the role of GDT1 family proteins in calcium homeostasis, At1g68650 might be involved in:

    • Stress-induced calcium signaling responses

    • Cellular adaptation to abiotic stresses like salt stress

    • Maintaining organellar calcium levels under stress conditions

  • Metal ion stress adaptation: Early transcriptional responses to iron deficiency in Arabidopsis suggest coordination of metal ion transport systems, potentially including At1g68650:

    • Iron deficiency responses (observed after 6-24 hours of treatment)

    • Regulation of cation transport systems (p-value 2.6e-02)

    • Adaptation to changing metal ion availability

Future research could explore targeted modifications of At1g68650 expression or function to enhance specific aspects of stress tolerance, particularly under conditions where mineral nutrient availability or ion homeostasis is disrupted.

What are the most promising future research directions for At1g68650 studies?

Several promising research directions could advance our understanding of At1g68650 and its applications:

  • Structural biology approaches:

    • Cryo-electron microscopy to determine the 3D structure of At1g68650

    • Structure-function analysis of the conserved E-φ-G-D-(KR)-(TS) motif

    • Computational modeling of transport mechanisms

  • Systems biology integration:

    • Transcriptomics under various stress conditions to identify co-regulated genes

    • Proteomics to identify the complete interactome of At1g68650

    • Metabolomics to detect changes in cellular metabolites related to At1g68650 function

  • Advanced genetic approaches:

    • CRISPR/Cas9 gene editing to introduce specific mutations in functional domains

    • Tissue-specific or inducible expression systems to study spatial and temporal roles

    • Creation of synthetic variants with enhanced or modified functions

  • Translational research:

    • Testing whether modifying At1g68650 expression affects stress tolerance in crop species

    • Exploring potential biotechnological applications in biofortification

    • Developing At1g68650-based biosensors for measuring ion concentrations

  • Evolutionary and comparative studies:

    • Comprehensive phylogenetic analysis across plant lineages

    • Functional comparison of At1g68650 homologs from plants adapted to extreme environments

    • Investigation of selection pressures on At1g68650 during plant evolution

These research directions would contribute to a more comprehensive understanding of At1g68650 function and potentially lead to practical applications in agriculture and biotechnology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.