Recombinant Arabidopsis thaliana Glutamate receptor 1.1 (GLR1.1)

Shipped with Ice Packs
In Stock

Description

Biological Roles and Research Findings

3.1 Regulation of Abscisic Acid (ABA) Biosynthesis and Drought Tolerance
GLR1.1 modulates ABA levels, impacting seed germination and drought responses:

  • ABA Sensitivity: GLR1.1-deficient lines (antiAtGLR1.1) exhibit heightened sensitivity to exogenous ABA, leading to inhibited germination and root growth. This phenotype is reversible with fluridone, an ABA biosynthesis inhibitor .

  • Drought Adaptation: AntiAtGLR1.1 mutants show elevated leaf ABA levels, reduced stomatal apertures, and enhanced drought tolerance due to decreased water loss .

3.2 C/N Metabolism and Nutrient Sensing
GLR1.1 acts as a sensor for C/N balance:

  • Germination Control: AntiAtGLR1.1 seeds fail to germinate under high sucrose conditions unless supplemented with nitrate (NO₃⁻), highlighting its role in C/N signaling .

  • Enzyme Regulation: GLR1.1 transcriptionally controls enzymes like hexokinase 1 (HXK1) and zeaxanthin epoxidase (ABA1), linking metabolic flux to developmental outcomes .

Ion Signaling and Stress Responses

  • Ca²⁺ Flux: GLR1.1-deficient seedlings display hypersensitivity to extracellular Ca²⁺, suggesting its role in ion homeostasis .

  • Wound Response: GLR homologs (e.g., GLR3.4) mediate trade-offs between regeneration and defense via salicylic acid (SA) signaling, though GLR1.1’s direct involvement requires further study .

Comparative Analysis of GLRMutants vs. Wild-Type (WT)

TraitWild-Type (WT)AntiAtGLR1.1 Mutants
Seed GerminationNormal under ABA or sucroseInhibited by ABA/sucrose; rescued by NO₃⁻ or fluridone
ABA LevelsBaselineElevated in leaves
Stomatal ApertureStandardReduced, enhancing drought tolerance
Gene ExpressionNormal ABA/ABI genesAltered ABA/ABI biosynthetic pathways

Applications and Research Implications

  • Agricultural Biotechnology: GLR1.1’s role in drought tolerance offers potential for engineering stress-resilient crops.

  • Nutrient Sensing Studies: Recombinant GLR1.1 facilitates in vitro assays to dissect C/N signaling mechanisms .

  • Structural Biology: The protein’s homology to iGluRs makes it a model for studying plant-specific ion channel evolution .

Challenges and Future Directions

  • Structural Resolution: High-resolution cryo-EM or crystallography of GLR1.1 is needed to clarify ligand-binding dynamics.

  • Field Trials: Translating laboratory findings on drought tolerance to field conditions remains untested.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
GLR1.1; GLR1; At3g04110; T6K12.27; Glutamate receptor 1.1; AtGLR1; Ligand-gated ion channel 1.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-808
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
GLR1.1
Target Protein Sequence
APSDDDVFEEVRVGLVVDLSSIQGKILETSFNLALSDFYGINNGYRTRVSVLVRDSQGDP IIALAAATDLLKNAKAEAIVGAQSLQEAKLLATISEKAKVPVISTFLPNTLSLKKYDNFI QWTHDTTSEAKGITSLIQDFSCKSVVVIYEDADDWSESLQILVENFQDKGIYIARSASFA VSSSGENHMMNQLRKLKVSRASVFVVHMSEILVSRLFQCVEKLGLMEEAFAWILTARTMN YLEHFAITRSMQGVIGFKSYIPVSEEVKNFTSRLRKRMGDDTETEHSSVIIGLRAHDIAC ILANAVEKFSVSGKVEASSNVSADLLDTIRHSRFKGLSGDIQISDNKFISETFEIVNIGR EKQRRIGLWSGGSFSQRRQIVWPGRSRKIPRHRVLAEKGEKKVLRVLVTAGNKVPHLVSV RPDPETGVNTVSGFCVEVFKTCIAPFNYELEFIPYRGNNDNLAYLLSTQRDKYDAAVGDI TITSNRSLYVDFTLPYTDIGIGILTVKKKSQGMWTFFDPFEKSLWLASGAFFVLTGIVVW LVERSVNPEFQGSWGQQLSMMLWFGFSTIVFAHREKLQKMSSRFLVIVWVFVVLILTSSY SANLTSTKTISRMQLNHQMVFGGSTTSMTAKLGSINAVEAYAQLLRDGTLNHVINEIPYL SILIGNYPNDFVMTDRVTNTNGFGFMFQKGSDLVPKVSREIAKLRSLGMLKDMEKKWFQK LDSLNVHSNTEEVASTNDDDEASKRFTFRELRGLFIIAGAAHVLVLALHLFHTRQEVSRL CTKLQSFYK
Uniprot No.

Target Background

Function

Recombinant Arabidopsis thaliana Glutamate receptor 1.1 (GLR1.1) is a glutamate-gated receptor functioning as a non-selective cation channel, transporting sodium, potassium, and calcium ions. It acts as a carbon and nitrogen regulator/sensor, controlling carbon and nitrogen metabolism and processes such as germination via regulation of abscisic acid (ABA) biosynthesis. GLR1.1 may also be involved in light-signal transduction and calcium homeostasis by regulating calcium influx. It is essential for regulating the ABA signaling pathway, influencing various aspects of plant physiology, including seed germination and drought response (e.g., stomatal opening).

Gene References Into Functions
  1. Research suggests that AtGLR1.1 integrates and regulates various aspects of carbon, nitrogen, and water balance crucial for normal plant growth and development. PMID: 15564521
Database Links

KEGG: ath:AT3G04110

STRING: 3702.AT3G04110.1

UniGene: At.18800

Protein Families
Glutamate-gated ion channel (TC 1.A.10.1) family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed predominantly in roots. First detected in the root-shoot junction, and later in lateral roots and at the margin of matures leaves.

Q&A

What is Glutamate Receptor 1.1 (GLR1.1) in Arabidopsis thaliana?

GLR1.1 is a member of the glutamate receptor-like (GLR) family in Arabidopsis thaliana. It functions primarily as a regulator of carbon and nitrogen metabolism. The mature protein spans from amino acids 20-808 and belongs to the GLR1 clade of the 20 GLRs identified in Arabidopsis. GLR1.1 exhibits structural and functional similarities to animal ionotropic glutamate receptors (iGLRs), potentially acting as a ligand-gated ion channel that influences various physiological processes in plants .

How does GLR1.1 differ from other glutamate receptors in Arabidopsis?

Based on phylogenetic analysis, Arabidopsis GLRs are organized into three distinct clades: GLR1, GLR2, and GLR3. GLR1.1 belongs to the GLR1 clade and has specialized functions in regulating carbon and nitrogen metabolism. While GLRs share structural similarities with animal ionotropic glutamate receptors (iGLRs), they possess unique binding specificities and functional properties. For instance, unlike some other GLRs that may primarily function in calcium signaling (such as GLR3.4 which localizes to pollen grain apertures and is associated with cell polarity), GLR1.1 appears to have a central role in metabolic regulation and seed germination .

What methods are used to study GLR1.1 function in Arabidopsis?

Researchers employ several approaches to investigate GLR1.1 function:

  • Antisense Strategy: Developing anti-AtGLR1.1 lines to examine the effects of decreased AtGLR1.1 peptide levels.

  • Vertical Growth Assays: Seeds are maintained in vertical position on square Petri plates with complete Murashige and Skoog (MS) medium or MS minus inorganic nitrogen medium, supplemented with different carbon or nitrogen compounds, amino acids, or iGLR antagonists/agonists.

  • Biochemical Analysis: Measurement of abscisic acid (ABA) titers, immunoblot analysis, isoenzyme assays, and RT-PCR to assess molecular changes.

  • Pharmacological Approaches: Using iGLR antagonists (e.g., DNQX) and agonists (e.g., BMAA) to manipulate GLR1.1 activity and observe physiological responses .

How can I generate recombinant GLR1.1 protein for in vitro studies?

The production of recombinant GLR1.1 typically follows this methodology:

  • Expression System Selection: E. coli is commonly used as the host organism for expressing recombinant Arabidopsis thaliana GLR1.1.

  • Construct Design: The full-length mature protein (amino acids 20-808) is often expressed with a His-tag for purification purposes.

  • Antibody Production: For studies requiring antibodies against GLR1.1, researchers have successfully produced antibodies by expressing the C-terminal 88 amino acids of AtGLR1.1 in a GST-fusion system. This involves PCR amplification with gene-specific primers, cloning, and purification of the truncated AtGLR1.1 protein.

  • Protein Purification: His-tagged proteins can be purified using standard affinity chromatography techniques .

What is the role of GLR1.1 in carbon and nitrogen metabolism?

GLR1.1 functions as a critical regulator of carbon and nitrogen metabolism in Arabidopsis thaliana. Research using anti-AtGLR1.1 lines has revealed that:

  • Decreased accumulation of AtGLR1.1 is associated with reduced carbon and nitrogen metabolism.

  • AtGLR1.1 appears to coordinate the crosstalk between biosynthetic pathways that control the flow of carbon and nitrogen.

  • The protein may function as a sensor that monitors metabolic status and regulates developmental and metabolic responses to different environmental conditions.

These findings suggest that GLR1.1 serves as a key component in the regulatory network that enables plants to balance carbon and nitrogen metabolism, which is essential for proper growth and development .

How does GLR1.1 influence seed germination in Arabidopsis?

GLR1.1 plays a crucial role in regulating seed germination through its effects on abscisic acid (ABA) signaling:

  • Seeds from AtGLR1.1-deficient (anti-AtGLR1.1) lines fail to germinate in the presence of ionotropic glutamate receptor (iGLR) antagonists.

  • Anti-AtGLR1.1 lines exhibit elevated ABA titers compared to wild-type plants.

  • Treatment with the iGLR antagonist DNQX further increases ABA levels and inhibits seed germination in anti-AtGLR1.1 lines.

  • Co-incubation with an iGLR agonist (BMAA) decreases ABA titers and restores germination.

These observations suggest that GLR1.1 controls seed germination by modulating ABA levels, with decreased GLR1.1 function leading to increased ABA accumulation and consequent inhibition of germination .

What is the relationship between GLR1.1 and abscisic acid (ABA) signaling?

The relationship between GLR1.1 and ABA signaling represents a complex regulatory mechanism:

ConditionABA LevelsGermination
Wild-typeBaselineNormal
Anti-AtGLR1.1ElevatedImpaired
Anti-AtGLR1.1 + DNQXFurther increasedInhibited
Anti-AtGLR1.1 + DNQX + BMAADecreasedRestored

GLR1.1 appears to function upstream of ABA biosynthesis or catabolism, as diminished GLR1.1 expression results in elevated ABA accumulation. The further increase in ABA levels upon treatment with the iGLR antagonist DNQX suggests that GLR1.1 activity negatively regulates ABA production or positively regulates ABA degradation. The ability of the iGLR agonist BMAA to reverse these effects implies that GLR1.1 signaling activity directly influences ABA homeostasis. This GLR1.1-ABA regulatory axis is critical for proper seed germination and likely plays roles in other developmental and stress-responsive processes in plants .

What are the challenges in studying GLR1.1 function in planta?

Several challenges complicate the study of GLR1.1 function in plants:

  • Functional Redundancy: The presence of multiple GLR genes in Arabidopsis (20 GLRs organized into 3 clades) may result in partial redundancy, making it difficult to isolate GLR1.1-specific functions through single gene knockout approaches.

  • Complex Phenotypes: GLR1.1 affects fundamental processes like carbon and nitrogen metabolism and seed germination, which are influenced by numerous other factors, complicating phenotypic analysis.

  • Ligand Identification: Determining the physiological ligands that modulate GLR1.1 activity remains challenging, as plant GLRs may respond to various amino acids or other metabolites with different affinities.

  • Structural Complexity: The tetrameric assembly and multi-domain architecture of GLRs present technical challenges for structural studies, limiting our understanding of structure-function relationships.

  • Tissue-Specific Expression: GLR1.1 may have different functions in different tissues or developmental stages, requiring sophisticated tissue-specific manipulation approaches .

How can I design experiments to distinguish GLR1.1-specific effects from those of other GLRs?

To isolate GLR1.1-specific functions:

  • Combine Genetic and Pharmacological Approaches: Use GLR1.1 knockout or knockdown lines in combination with iGLR antagonists/agonists that have differential effects on various GLR family members.

  • Domain Swapping Experiments: Create chimeric proteins by swapping domains between GLR1.1 and other GLRs to identify regions responsible for specific functions.

  • Tissue-Specific Manipulation: Employ tissue-specific promoters to express or suppress GLR1.1 in specific cell types.

  • Temporal Control Systems: Use inducible expression or repression systems to manipulate GLR1.1 levels at specific developmental stages.

  • Higher-Order Mutants: Generate double or triple mutants combining GLR1.1 with related GLRs to assess additive or synergistic effects that might reveal functional relationships.

This multi-faceted approach can help disentangle GLR1.1-specific functions from those potentially shared with other GLR family members .

What methodologies are effective for analyzing GLR1.1's role in metabolic regulation?

Effective methodologies include:

  • Metabolomics Analysis: Comprehensive profiling of metabolites in wild-type and GLR1.1-altered plants under various conditions to identify affected metabolic pathways.

  • Isotope Labeling: Use of 13C or 15N-labeled compounds to trace carbon and nitrogen flux through different metabolic pathways in the presence or absence of functional GLR1.1.

  • Enzyme Activity Assays: Measurement of activities of key enzymes involved in carbon and nitrogen metabolism to identify specific steps regulated by GLR1.1.

  • Transcriptomics: RNA-seq analysis to identify genes differentially expressed in response to altered GLR1.1 function, revealing potential regulatory networks.

  • Electrophysiology: Patch-clamp techniques to measure ion channel properties of GLR1.1 in native membranes or heterologous expression systems.

  • Calcium Imaging: Real-time monitoring of calcium fluxes in response to GLR1.1 activation or inhibition to assess its role in calcium signaling .

How do I interpret contradictory findings regarding GLR1.1 function?

When faced with contradictory results:

  • Consider Experimental Conditions: Differences in growth conditions, developmental stages, or tissue types can significantly influence GLR1.1 function and the resulting phenotypes.

  • Evaluate Genetic Background Effects: The impact of GLR1.1 manipulation may vary depending on the ecotype or genetic background used in different studies.

  • Assess Methodology Differences: Various approaches to altering GLR1.1 function (knockout, knockdown, overexpression) may yield different or even opposing effects.

  • Analyze Degree of Manipulation: Partial versus complete loss of GLR1.1 function can result in quantitatively or qualitatively different phenotypes.

  • Consider Compensatory Mechanisms: Long-term versus acute alterations in GLR1.1 function may allow for compensatory changes in related pathways.

Systematically evaluating these factors can help reconcile apparently contradictory findings and develop a more nuanced understanding of GLR1.1 function .

What are promising research directions for understanding GLR1.1's role in plant stress responses?

Promising research avenues include:

  • Drought and Osmotic Stress: Given GLR1.1's connection to ABA signaling, investigating its role in drought responses could reveal important regulatory mechanisms.

  • Nutrient Stress Responses: As a regulator of carbon and nitrogen metabolism, GLR1.1 likely plays a role in adapting to nutrient limitation or imbalance.

  • Cross-Talk with Stress Signaling Pathways: Examining interactions between GLR1.1 and key stress response pathways (ABA, jasmonic acid, salicylic acid, ethylene) could uncover novel regulatory nodes.

  • Evolution of GLR Functions: Comparative studies across plant species could reveal how GLR1.1 functions have diversified during evolution and adapted to different ecological niches.

  • Structure-Guided Drug Design: Developing specific modulators of GLR1.1 activity based on structural insights could provide valuable tools for agricultural applications.

These research directions could significantly advance our understanding of plant stress adaptation mechanisms and potentially lead to improved crop resilience strategies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.