Recombinant Arabidopsis thaliana Glycerol-3-phosphate acyltransferase 1 (GPAT1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Arabidopsis thaliana Glycerol-3-Phosphate Acyltransferase 1 (GPAT1)

Recombinant Arabidopsis thaliana GPAT1 is a heterologously expressed, full-length protein (1–585 amino acids) derived from the AtGPAT1 gene (UniProt ID: Q9SHJ5). This enzyme belongs to the membrane-bound GPAT family and catalyzes the first step in glycerolipid biosynthesis by transferring acyl groups from acyl-CoA to glycerol-3-phosphate (G3P) at the sn-1 position . Produced in E. coli with an N-terminal His-tag for purification, it is critical for studying lipid metabolism, particularly in pollen development and seed oil biosynthesis .

Enzymatic Specificity

GPAT1 exhibits strict sn-1 regiospecificity, exclusively acylating G3P without competing substrates like lysophosphatidic acid or sterols . Its substrate preference varies under experimental conditions:

ConditionPreferred Acyl-CoAKey Observations
No EDTA16:1 and 18:1Higher activity with unsaturated fatty acids
With EDTA (5 mM)18:0 (stearoyl-CoA)Shift toward saturated fatty acids

This dual specificity suggests complex in vivo regulation influenced by cellular cofactors .

Pollen Development and Male Fertility

GPAT1 is essential for tapetum degeneration and pollen maturation:

  1. Tapetum Disruption: atgpat1-1 mutants show altered endoplasmic reticulum profiles and defective lipid body formation in pollen .

  2. Gametophytic Defects: Pollen grains lacking GPAT1 exhibit impaired competitive fertilization ability .

Seed Oil Biosynthesis

  • Lipid Profile Changes: Mutants show reduced triacylglycerol (TAG) content and altered fatty acid composition (e.g., increased 18:2 and 18:3, decreased 16:0) .

  • Seed Yield Impact: GPAT1 knockout reduces seed yield but paradoxically increases plant height, likely due to altered cell elongation .

Research Applications

  • Enzymatic Assays: Used to study substrate specificity and acyltransferase activity in vitro .

  • Protein Purification: His-tag facilitates affinity chromatography for structural or functional studies .

Comparative Analysis with Other GPATs

GPAT IsoformCladeLocalizationSubstratesProductsBiological Role
GPAT1Third CladeER MembraneUnsaturated/saturated acyl-CoAssn-1 lysophosphatidic acidMembrane lipids, pollen/seed lipids
GPAT4/6/8First CladeER Membraneω-Oxidized C16/C18 acyl-CoAs2-monoacylglycerols (MAGs)Cutin biosynthesis
GPAT5Second CladeER MembraneLong-chain acyl-CoAssn-2 lysophosphatidic acidsSuberin biosynthesis

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes if different. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
GPAT1; At1g06520; F12K11.15; Glycerol-3-phosphate acyltransferase 1; AtGPAT1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-585
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
GPAT1
Target Protein Sequence
MVLPELLVILAEWVLYRLLAKSCYRAARKLRGYGFQLKNLLSLSKTQSLHNNSQHHLHNH HQQNHPNQTLQDSLDPLFPSLTKYQELLLDKNRACSVSSDHYRDTFFCDIDGVLLRQHSS KHFHTFFPYFMLVAFEGGSIIRAILLLLSCSFLWTLQQETKLRVLSFITFSGLRVKDMDN VSRSVLPKFFLENLNIQVYDIWARTEYSKVVFTSLPQVLVERFLREHLNADDVIGTKLQE IKVMGRKFYTGLASGSGFVLKHKSAEDYFFDSKKKPALGIGSSSSPQDHIFISICKEAYF WNEEESMSKNNALPRERYPKPLIFHDGRLAFLPTPLATLAMFIWLPIGFLLAVFRISVGV FLPYHVANFLASMSGVRITFKTHNLNNGRPEKGNSGVLYVCNHRTLLDPVFLTTSLGKPL TAVTYSLSKFSEFIAPLKTVSLKRDRKKDGEAMQRLLSKGDLVVCPEGTTCREPYLLRFS PLFAELTEDIVPVAVDARVSMFYGTTASGLKCLDPIFFLMNPRPVYCLEILKKLPKEMTC AGGKSSFEVANFIQGELARVLGFECTNLTRRDKYLVLAGNEGIVR
Uniprot No.

Target Background

Function
This recombinant *Arabidopsis thaliana* Glycerol-3-phosphate acyltransferase 1 (GPAT1) esterifies acyl groups from acyl-ACP to the sn-1 position of glycerol-3-phosphate. This is a crucial step in glycerolipid biosynthesis. GPAT1 is involved in pollen development, specifically tapetum differentiation and male fertility. Its function extends beyond the sporophyte, also influencing pollen performance through a gametophytic effect.
Database Links

KEGG: ath:AT1G06520

STRING: 3702.AT1G06520.1

UniGene: At.27686

Protein Families
GPAT/DAPAT family
Subcellular Location
Membrane; Multi-pass membrane protein. Mitochondrion. Note=According to PubMed:12897259 it is mitochondrial. However, no clear transit peptide is predicted by sequence analysis tools.
Tissue Specificity
Highly expressed in developing siliques and flower buds. Weakly or not expressed in roots, seedlings and leaves.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.