Recombinant Arabidopsis thaliana High-affinity nitrate transporter 3.1 (NRT3.1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and confirmed in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
NRT3.1; NAR2.1; NAR2.2; WR3; At5g50200; K6A12.6; High-affinity nitrate transporter 3.1; Protein WOUND-RESPONSIVE 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-210
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
NRT3.1
Target Protein Sequence
AEKVRLFKELDKGALDVTTKPSREGPGVVLDAGKDTLNITWTLSSIGSKREAEFKIIKVK LCYAPPSQVDRPWRKTHDELFKDKTCPHKIIAKPYDKTLQSTTWTLERDIPTGTYFVRAY AVDAIGHEVAYGQSTDDAKKTNLFSVQAISGRHASLDIASICFSVFSVVALVVFFVNEKR KAKIEQSK
Uniprot No.

Target Background

Function
Recombinant Arabidopsis thaliana High-affinity nitrate transporter 3.1 (NRT3.1) functions as a dual-component transporter in conjunction with NTR2.1, essential for high-affinity nitrate uptake. It also acts as a repressor of lateral root initiation and may play a role in targeting NRT2 proteins to the plasma membrane.
Gene References Into Functions
  1. In Arabidopsis thaliana, AtNRT2.5, predominantly expressed in roots under nitrate deprivation, forms a 150 kDa complex with AtNAR2.1, primarily responsible for constitutive high-affinity nitrate influx. [NAR2.1] PMID: 25474587
  2. With the exception of AtNRT2.7, all other NRT2 transporters exhibit strong interaction with AtNAR2.1. PMID: 22432443
  3. Studies demonstrate the plasma membrane localization of an intact AtNRT2.1 and AtNAR2.1 (AtNRT3.1) two-component complex. PMID: 20561257
  4. Functional AtNRT3 genes are required for both constitutive and nitrate-inducible high-affinity nitrate influx in higher plant roots (but not low-affinity influx). [AtNRT3.1] PMID: 16415212
  5. The NRT3.1 gene encodes a crucial component of the high-affinity NO3 transport system (HATS), and high nitrate-mediated repression of NRT2.1 and NRT3.1 is specifically regulated by the NRT1.1 transporter. [NRT3.1] PMID: 16998085
  6. AtNAR2.1 is essential for the high-affinity nitrate transport system in Arabidopsis. [NAR2.1] PMID: 17012411
Database Links

KEGG: ath:AT5G50200

STRING: 3702.AT5G50200.1

UniGene: At.21028

Protein Families
NAR2 family
Subcellular Location
Cell membrane; Single-pass membrane protein.
Tissue Specificity
Highly expressed in roots. Detected in shoots.

Q&A

Basic Research Questions

  • What is NRT3.1 and what is its function in Arabidopsis thaliana?

    NRT3.1 (also known as NAR2.1) is a critical component of the high-affinity nitrate transport system (HATS) in Arabidopsis thaliana. While it lacks independent nitrate transport activity, it functions as an essential partner protein that interacts with NRT2 family transporters to form functional nitrate uptake complexes.

    Methodology for functional characterization:

    • Generate knockout mutants (e.g., Atnrt3.1-1, Atnrt3.1-2) to assess nitrate uptake impairment

    • Measure 15NO3− influx in roots of wild-type vs. mutant plants

    • Analyze expression patterns using promoter-reporter gene fusions

    NRT3.1 accounts for greater than 99% of NRT3 mRNA in Arabidopsis and is induced by nitrate. Mutations in this gene significantly reduce nitrate uptake rates and alter the expression of other nitrate transporters, demonstrating its central role in nitrogen acquisition .

  • How is NRT3.1 expression regulated in plant tissues?

    NRT3.1 expression is regulated through multiple mechanisms:

    Regulatory FactorEffect on NRT3.1 ExpressionMechanism
    Nitrate availabilityInduced by nitrateTranscriptional activation
    NRT1.1 transporterRepressed by high external nitrateNRT1.1-mediated signaling pathway
    N metabolitesFeedback repressionIndependent of NRT1.1 pathway
    Tissue specificityPrimarily expressed in rootsDevelopmental regulation

    Research has established that both NRT2.1 and NRT3.1 are coordinately regulated, with expression patterns that respond similarly to environmental nitrogen conditions. When nitrate provision is low, the NRT1.1-mediated repression of NRT3.1 is relieved, allowing reactivation of the high-affinity transport system. This dual regulatory mechanism (involving both feedback repression by N metabolites and NRT1.1-mediated repression) ensures optimal nitrate uptake under various environmental conditions .

  • What are the established experimental systems for studying recombinant NRT3.1?

    Several experimental systems have been validated for studying NRT3.1 function:

    • Heterologous expression systems:

      • Xenopus oocytes for transport assays

      • Yeast mutants (e.g., Hansenula polymorpha Δynt1) for complementation studies

    • Plant-based systems:

      • T-DNA insertion mutants (Atnrt3.1-1, Atnrt3.1-2)

      • Transgenic Arabidopsis expressing recombinant NRT3.1

      • Hydroponic culture systems with controlled nitrate concentrations

    • Protein interaction studies:

      • Membrane yeast split-ubiquitin system

      • Bimolecular fluorescence complementation in Arabidopsis protoplasts

    When selecting an experimental system, researchers should consider that recombinant NRT3.1 is typically stored at -20°C/-80°C and shipped as a lyophilized powder that should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol for long-term storage .

Advanced Research Questions

  • How does NRT3.1 interact with NRT2 family proteins to facilitate nitrate transport?

    NRT3.1 forms physical complexes with multiple NRT2 family members to create functional high-affinity nitrate transporters. The interaction mechanism has been characterized through multiple approaches:

    NRT2 Family MemberInteraction with NRT3.1Functional Effect
    NRT2.1Forms 150-kDa plasma membrane complexConstitutes primary HATS
    NRT2.2Strong interaction confirmedSignificant increase in nitrate uptake
    NRT2.3Strong interaction confirmedSignificant increase in nitrate uptake
    NRT2.4Strong interaction confirmedSignificant increase in nitrate uptake
    NRT2.5Strong interaction confirmedSignificant increase in nitrate uptake
    NRT2.6Strong interaction confirmedSignificant increase in nitrate uptake
    NRT2.7No interaction detectedIndependent function

    The research employed three complementary systems to validate these interactions: membrane yeast split-ubiquitin, bimolecular fluorescence complementation in A. thaliana protoplasts, and co-expression in Xenopus oocytes. All NRT2 transporters except NRT2.7 restored growth and β-galactosidase activity in the yeast split-ubiquitin system and showed split-YFP fluorescence in A. thaliana protoplasts only when co-expressed with NRT3.1 .

    Co-injection of cRNA of all NRT2 genes (except NRT2.7) with NRT3.1 cRNA into Xenopus oocytes resulted in statistically significant increases in nitrate uptake compared to single cRNA injections, confirming the functional importance of these protein-protein interactions .

  • How do mutations in NRT3.1 affect nitrate uptake and gene expression networks?

    Mutations in NRT3.1 have profound effects on both nitrate uptake and the regulation of other nitrate transporters:

    Two T-DNA insertion mutants, Atnrt3.1-1 (promoter disruption) and Atnrt3.1-2 (coding region disruption), show distinct molecular phenotypes:

    ParameterWild-typeAtnrt3.1-1Atnrt3.1-2
    Nitrate uptake efficiencyNormalSignificantly reducedSeverely reduced
    AtNRT1.1 expressionStrong induction by nitrate50% lower than wild-type75% lower than wild-type
    AtNRT2.1 expression~20-fold induction by nitrateLower than wild-typeLowest expression

    These results demonstrate that NRT3.1 not only participates directly in nitrate uptake but also influences the expression of other key nitrate transporters. The severity of the phenotype follows the pattern: wild-type > Atnrt3.1-1 > Atnrt3.1-2, suggesting that coding region mutations have more severe consequences than promoter disruptions .

    Interestingly, AtNRT1.1 levels in shoots of the mutants were similar to wild-type, whereas AtNRT2.1 expression was affected in both roots and shoots, indicating tissue-specific regulatory networks .

  • How does the NRT3.1-NRT2.1 complex respond to changing environmental nitrogen conditions?

    The NRT3.1-NRT2.1 complex exhibits sophisticated regulatory responses to changing nitrogen conditions:

    Environmental ConditionEffect on NRT3.1-NRT2.1 ComplexPhysiological Consequence
    Low nitrate (<0.5 mM)Increased expression of both genesEnhanced high-affinity uptake
    High nitrate (>1 mM)NRT1.1-mediated repressionDecreased high-affinity uptake
    High ammonium or glutamine (≥1 mM)Complex regulation: initial repression followed by up-regulation when nitrate decreasesBalanced uptake of different N forms
    N starvationStrong induction of NRT2.1-NRT3.1Maximized scavenging capacity

    These responses represent a sophisticated regulatory mechanism that balances the uptake of different nitrogen forms while preventing toxicity. When external nitrate is low but ammonium/glutamine is high, the NRT1.1-mediated repression of NRT2.1/NRT3.1 is relieved, allowing reactivation of the high-affinity transport system .

    This constitutes a crucial adaptive response against nitrate toxicity because the nitrate taken up by the high-affinity transport system prevents the detrimental effects of pure ammonium nutrition. The coordinated regulation of NRT2.1 and NRT3.1 ensures that nitrate uptake is optimized according to both external availability and internal plant demand .

  • How do NRT3 family members compare across different plant species?

    Comparative genomic analysis reveals both conservation and diversity in NRT3 family members across plant species:

    Plant SpeciesNumber of NRT3 GenesKey Characteristics
    Arabidopsis thaliana2 (NRT3.1, NRT3.2)NRT3.1 accounts for >99% of expression
    Oryza sativa (rice)2Similar structure to Arabidopsis NRT3s
    Zea mays (maize)2Similar structure to Arabidopsis NRT3s
    Hordeum vulgare (barley)3All contain signal peptides (21-25 amino acids)
    Triticum aestivum (wheat)11Grouped into different clades and homoeologous subgroups

    All identified NRT3 proteins contain N-terminal signal peptides, suggesting conservation of this structural feature across species. The expanded number of NRT3 genes in barley and wheat compared to Arabidopsis, rice, and maize suggests potential functional diversification in these species .

    The wheat NRT3 genes show diverse expression patterns in response to nitrogen starvation and nitrate resupply, suggesting functional specialization within this larger gene family. This diversity may contribute to the adaptation of different plant species to various nitrogen environments .

  • What methodological approaches are most effective for studying recombinant NRT3.1 function?

    Several complementary methodological approaches have proven effective for studying NRT3.1 function:

    Genetic approaches:

    • T-DNA insertion mutants (e.g., Atnrt3.1-1, Atnrt3.1-2)

    • CRISPR/Cas9 gene editing for precise mutations

    • Complementation studies with wild-type or modified NRT3.1

    Expression analysis:

    • Real-time RT-PCR for transcript quantification

    • Promoter-reporter gene fusions (GUS, GFP) for spatial expression patterns

    • RNA-seq for transcriptome-wide effects of NRT3.1 mutation

    Protein interaction studies:

    • Membrane yeast split-ubiquitin system

    • Bimolecular fluorescence complementation in protoplasts

    • Co-immunoprecipitation with NRT2 family members

    • FRET/FLIM for in vivo interaction dynamics

    Functional assays:

    • 15N-labeled nitrate uptake measurements

    • Electrophysiology in Xenopus oocytes

    • Growth assays under various nitrogen regimes

    When designing experiments, researchers should consider combining multiple approaches to provide complementary evidence. For example, interactions identified in yeast systems should be validated in planta, and functional effects observed in heterologous systems should be confirmed in Arabidopsis .

  • How can recombinant NRT3.1 be used to investigate nitrate signaling pathways?

    Recombinant NRT3.1 serves as a valuable tool for investigating nitrate signaling pathways through several experimental approaches:

    • Structure-function analysis: Site-directed mutagenesis of recombinant NRT3.1 can identify residues critical for interaction with NRT2 family members or other signaling components.

    • Protein-protein interaction networks: Pull-down assays with His-tagged recombinant NRT3.1 can identify novel interaction partners beyond the NRT2 family.

    • Phosphorylation studies: In vitro kinase assays with recombinant NRT3.1 can identify regulatory phosphorylation sites that modulate its function.

    • Antibody production: Purified recombinant NRT3.1 can be used to generate specific antibodies for immunolocalization and western blot analyses to study protein expression and localization.

    • Nitrate sensing mechanisms: Testing the ability of recombinant NRT3.1 to complement specific mutant phenotypes can reveal its role in nitrate perception versus transport.

    The recombinant protein approach is particularly valuable because it allows controlled manipulation and analysis of NRT3.1 function outside the complex regulatory environment of the plant cell. By combining in vitro studies of recombinant NRT3.1 with in vivo functional analyses, researchers can gain comprehensive insights into how this protein contributes to both nitrate transport and signaling pathways .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.