Recombinant Arabidopsis thaliana High-affinity nitrate transporter 3.2 (NRT3.2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
NRT3.2; At4g24715; F22K18.80; High-affinity nitrate transporter 3.2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-209
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
NRT3.2
Target Protein Sequence
GKKDRLFTDLQNSIEVTAKPVKDSGVLEAGKDMVTITWKLKSSSAKVDTDTAFKTIQVKL CYAPISQVDRPWRKTDNKLFKDRSCPHEIVSKAYDKTPQSLDWTIGLDIPTGTYFVRAYG IDGDGHEVAYGQSTDEGRTTNLFSVHAISGHHVGLDIASTFFSVFSVVSLFVFFVMEKRK AKLEQRE
Uniprot No.

Target Background

Function
Functions as a dual-component transporter with NTR2.1, essential for high-affinity nitrate transport.
Database Links

KEGG: ath:AT4G24715

UniGene: At.43613

Protein Families
NAR2 family
Subcellular Location
Cell membrane; Single-pass membrane protein.
Tissue Specificity
Bearly detected in roots and shoots.

Q&A

What is NRT3.2 and how does it differ from other nitrate transporters in Arabidopsis?

NRT3.2 (At4G24730) is one of two NAR2-like genes in Arabidopsis thaliana, with the other being NRT3.1 (also known as AtNAR2.1). Unlike the NRT1 and NRT2 families that directly transport nitrate, NRT3 family proteins have no known transport activity themselves but are required for high-affinity nitrate uptake . The key difference between NRT3.2 and NRT3.1 is their expression pattern - AtNRT3.1 accounts for more than 99% of NRT3 mRNA and is induced 6-fold by nitrate, whereas AtNRT3.2 is expressed constitutively at a very low level . Notably, AtNRT3.2 does not compensate for the loss of AtNRT3.1 in Atnrt3.1 mutants, suggesting distinct physiological roles .

How is NRT3.2 regulated in response to nitrogen availability?

Unlike NRT3.1, which shows significant regulation in response to nitrogen availability, NRT3.2 is expressed constitutively at very low levels . Most research has focused on NRT3.1 due to its higher expression and clear nitrate-responsive regulation. In contrast to the rapid transcriptional changes seen with NRT2.1, NRT2.2, and NRT3.1A in response to nitrogen starvation and resupply , NRT3.2 does not show substantial changes in expression under varying nitrogen conditions. This constitutive but low expression pattern suggests NRT3.2 may serve a specialized or maintenance function rather than being a primary responder to nitrogen fluctuations.

What protein characteristics define the NRT3.2 transporter?

NRT3.2 belongs to the calcineurin-like metallo-phosphoesterase superfamily of proteins . Unlike the NRT2 transporters that are members of the major facilitator superfamily , NRT3.2 does not have a known direct transport function. Rather than functioning independently, NAR2/NRT3 proteins are thought to serve as partner proteins that interact with NRT2 transporters to form functional complexes at the plasma membrane . The recombinant protein can be produced in various expression systems including E. coli, yeast, baculovirus, or mammalian cells, with a molecular weight corresponding to the expected size of the NRT3.2 protein .

What experimental systems have been used to study NRT3.2 function and interactions?

Several complementary experimental systems have been employed to study NRT3 protein interactions with NRT2 family members, though most studies have focused on NRT3.1 rather than NRT3.2:

For specific NRT3.2 studies, researchers would need to adapt these established methods while accounting for the substantially lower expression levels of NRT3.2 compared to NRT3.1.

How do NRT3.2 and NRT3.1 differ in their interactions with NRT2 family transporters?

While both NRT3.1 and NRT3.2 are NAR2-like proteins, they exhibit differences in their interactions with NRT2 family transporters:

  • Interaction Partners: NRT3.1 has been shown to interact with multiple NRT2 family members (NRT2.1-2.6, with the exception of NRT2.7) . These interactions are critical for targeting and stabilizing NRT2 proteins at the plasma membrane . Comprehensive studies specifically examining NRT3.2 interactions are more limited.

  • Functional Consequences: Co-expression of NRT2 transporters with NRT3.1 in Xenopus oocytes results in significantly increased nitrate uptake activity . The AtNRT2.1 and AtNAR2.1/NRT3.1 form a 150-kDa plasma membrane complex that constitutes the high-affinity nitrate transporter in Arabidopsis roots . Equivalent studies with NRT3.2 are needed to determine if it forms similar functional complexes.

  • Physiological Redundancy: The inability of NRT3.2 to compensate for NRT3.1 loss in Atnrt3.1 mutants suggests distinct functions rather than redundancy between these two proteins , despite their structural similarities.

What methodological challenges exist when studying low-abundance proteins like NRT3.2?

Investigating low-abundance proteins like NRT3.2 presents several technical challenges that researchers must address:

  • Detection Sensitivity: Standard RNA and protein detection methods may be insufficient for reliably quantifying NRT3.2 expression. Advanced techniques such as digital PCR, RNA-seq with deep coverage, or targeted proteomics approaches may be necessary.

  • Functional Redundancy Assessment: Determining the specific function of NRT3.2 requires careful experimental design to distinguish its activities from the more abundant NRT3.1. This may involve creating double mutants and complementation lines with tissue-specific or inducible expression systems.

  • Recombinant Protein Production: Expressing functionally active recombinant NRT3.2 requires optimization of expression systems. While E. coli-based systems are commonly used , eukaryotic expression systems might provide better protein folding and post-translational modifications for functional studies.

  • Protein-Protein Interaction Studies: Due to its low abundance, traditional co-immunoprecipitation approaches may be challenging. More sensitive techniques like proximity labeling (BioID, APEX) coupled with mass spectrometry might be more suitable for identifying NRT3.2 interaction partners in planta.

What is the relationship between NRT3.2 and nitrogen use efficiency in plants?

Understanding NRT3.2's contribution to nitrogen use efficiency (NUE) requires integrating findings across several areas:

What experimental approaches are recommended for functional characterization of recombinant NRT3.2?

For researchers working with recombinant NRT3.2, the following methodological approaches are recommended:

  • Heterologous Expression Systems:

    • Xenopus oocyte expression system for transport assays

    • Yeast expression for protein-protein interaction studies

    • Insect or mammalian cell expression for structural studies

  • Protein Quality Assessment:

    • Verify protein integrity using Western blotting with specific antibodies

    • Assess protein folding using circular dichroism or limited proteolysis

    • Confirm membrane localization in expression systems using fluorescent tags or subcellular fractionation

  • Functional Assays:

    • Co-expression with various NRT2 family transporters to identify functional partners

    • 14C-labeled nitrate uptake assays in heterologous systems

    • Electrophysiological measurements in Xenopus oocytes to characterize transport kinetics

  • Structural Studies:

    • Protein-protein docking models with NRT2 transporters

    • Cryogenic electron microscopy of NRT3.2-NRT2 complexes if sufficient protein yields can be achieved

    • Cross-linking mass spectrometry to identify interaction interfaces

How can NRT3.2 research contribute to improving crop nitrogen use efficiency?

Translating NRT3.2 research from Arabidopsis to crops offers several potential applications:

  • Comparative Genomics Approach: Identifying NRT3.2 orthologs in crops like wheat, where seven NRT2 and eleven NRT3 genes have been identified , could reveal crop-specific adaptations in nitrogen transport systems.

  • Expression Optimization: Engineering altered expression patterns of NRT3.2 or its crop orthologs might enhance nitrogen uptake under specific environmental conditions where the more abundant NRT3.1 is less effective.

  • Structure-Function Analysis: Understanding the specific structural features that determine NRT3.2 interactions with NRT2 transporters could guide protein engineering approaches to enhance nitrogen transport efficiency.

  • Integration with Other Transport Systems: Examining how NRT3.2 functions in concert with other nitrogen transport systems, including NRT1/NPF family transporters like the dual-affinity transporter NRT1.1 , could provide insights for holistic improvement of plant nitrogen acquisition.

What are the current gaps in our understanding of NRT3.2 function?

Despite advances in understanding nitrate transport systems, several key questions about NRT3.2 remain unanswered:

  • Physiological Relevance: Given its low expression compared to NRT3.1, what specific physiological conditions might require NRT3.2 function? Does it serve as a backup system or fulfill a specialized role?

  • Regulation Mechanisms: What transcriptional and post-translational mechanisms regulate NRT3.2 expression and activity? Does it undergo phosphorylation or other modifications similar to the phosphorylation-controlled dimerization observed for other transporters ?

  • Evolutionary Conservation: How conserved is NRT3.2 function across plant species, particularly in crops with varying nitrogen use strategies?

  • Subcellular Dynamics: How does NRT3.2 traffic to the plasma membrane, and what cellular machinery is involved in its proper localization and turnover?

  • Structural Determinants: What specific protein domains mediate NRT3.2 interactions with NRT2 family transporters, and how do these differ from NRT3.1 interaction interfaces?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.