Recombinant Arabidopsis thaliana HVA22-like protein a (HVA22A)

Shipped with Ice Packs
In Stock

Description

Stress Response and Vesicular Trafficking

HVA22A is induced by abscisic acid (ABA) and abiotic stresses (e.g., drought, salt). Its primary roles include:

  • Inhibition of Gibberellin (GA)-Mediated Processes: Overexpression in barley aleurone cells suppresses GA-induced vacuolation and programmed cell death (PCD) . This is mediated by disrupting vesicular trafficking between ER/Golgi and protein storage vacuoles (PSVs).

  • Antioxidant Regulation: Enhances salt and drought tolerance in plants by modulating oxidative stress responses .

Interaction with Viral Proteins

HVA22A interacts with the 6K2 protein of Turnip Mosaic Virus (TuMV), a critical component of viral replication compartments. This interaction occurs at plasmodesmata (PD) and facilitates viral propagation. Overexpression of HVA22A enhances TuMV replication, while CRISPR-mediated mutagenesis reduces viral spread .

Functional InteractionMechanismOutcome
TuMV 6K2Interaction at viral replication sitesEnhanced viral propagation
GA SignalingDisruption of ER/Golgi traffickingSuppressed vacuolation/PCD

Stress Tolerance

  • Overexpression Studies: In Arabidopsis, GhHVA22E1D (a cotton homolog) enhances salt and drought resistance by improving antioxidant capacity .

  • Virus-Induced Gene Silencing (VIGS): Silencing GhHVA22E1D in cotton reduces stress tolerance, highlighting its role in abiotic stress adaptation .

Viral Pathogenesis

  • Agonistic Role in TuMV Infection: HVA22A’s C-terminal tail is critical for interaction with TuMV 6K2, suggesting a potential target for antiviral strategies .

Comparative Insights with Homologs

HVA22A belongs to a multigenic family with diverse functions. Key comparisons include:

ProteinFunctionLocalization
HVA22 (Barley)Inhibits GA-mediated PCDER/Golgi
AtHVA22DSimilar to HVA22 in inhibiting vacuolationER/Golgi
OsHLP1 (Rice)Enhances blast resistance by disrupting ERER

Future Directions

  • Mechanistic Studies: Elucidating the role of HVA22A’s transmembrane domains in ER/Golgi dynamics.

  • Biotechnological Applications: Engineering HVA22A variants for improved stress tolerance or virus resistance in crops.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Note: Tag type is determined during production. To prioritize a specific tag, please inform us during your order placement.
Synonyms
HVA22A; At1g74520; F1M20.20; HVA22-like protein a; AtHVA22a
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-177
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
HVA22A
Target Protein Sequence
MGSGAGNFLKVLLRNFDVLAGPVVSLVYPLYASVQAIETQSHADDKQWLTYWVLYSLLTL IELTFAKLIEWLPIWSYMKLILTCWLVIPYFSGAAYVYEHFVRPVFVNPRSINIWYVPKK MDIFRKPDDVLTAAEKYIAENGPDAFEKILSRADKSKRYNKHEYESYETMYGEGYQY
Uniprot No.

Target Background

Database Links

KEGG: ath:AT1G74520

STRING: 3702.AT1G74520.1

UniGene: At.24678

Protein Families
DP1 family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Predominantly expressed in flower buds and stem.

Q&A

What is Arabidopsis thaliana HVA22-like protein a (HVA22A) and what family does it belong to?

HVA22A is an ABA/stress-induced protein belonging to the HVA22 family in Arabidopsis thaliana. It is part of the broader Receptor expression-enhancing protein (Reep)/Deleted in polyposis (DP1)/Yop1 family found across eukaryotes. The protein contains a conserved TB2/DP1 domain and features a structure with a short hydrophilic loop flanked by two hydrophobic stretches similar to yeast Yop1p . Notably, HVA22 homologs are widely distributed in eukaryotic organisms but absent in prokaryotes, suggesting involvement in eukaryote-specific functions .

How should researchers handle and reconstitute recombinant HVA22A protein?

For optimal experimental outcomes with recombinant HVA22A:

  • Storage conditions:

    • Store at -20°C/-80°C upon receipt

    • Aliquot to avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

  • Reconstitution protocol:

    • Briefly centrifuge the vial before opening to bring contents to the bottom

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to 5-50% final concentration for long-term storage

    • The default final concentration of glycerol is 50%

What are the known cellular functions of HVA22A in plants?

HVA22A functions as a negative regulator of gibberellin (GA)-mediated processes in plants. Key functions include:

  • Inhibition of vacuolation: HVA22A inhibits GA-induced formation of large digestive vacuoles, an important aspect of programmed cell death (PCD) in aleurone cells .

  • Regulation of vesicular trafficking: Located in the ER and Golgi apparatus, HVA22A appears to inhibit vesicular trafficking involved in nutrient mobilization, delaying coalescence of protein storage vacuoles (PSVs) .

  • Seed dormancy and germination: HVA22A expression correlates with seed dormancy status, with transcripts degrading within 12 hours after imbibition in non-dormant seeds while remaining high in dormant grains .

  • Virus propagation: AtHVA22a plays an agonistic role in turnip mosaic virus (TuMV) propagation, with its C-terminal tail being important in this process .

How does HVA22A interact with plant hormone signaling pathways?

HVA22A sits at a critical junction between ABA and GA signaling pathways:

  • ABA induction: HVA22A expression is strongly induced by ABA through the ABA response complex in its promoter .

  • GA antagonism: HVA22A functions downstream of the GAMyb transcription factor, which is a crucial positive regulator of GA-induced events. Overexpression of HVA22 inhibits GAMyb-induced vacuolation by approximately 40% .

  • Signaling cascade: In the GA signaling pathway, SLN1 negatively regulates GAMyb, which promotes PCD. HVA22A acts downstream of GAMyb to inhibit PCD-associated vacuolation .

  • Hormone balance: The antagonistic relationship between ABA (inducing HVA22A) and GA (promoting processes inhibited by HVA22A) demonstrates how these hormone pathways coordinate to regulate developmental transitions like seed germination .

What experimental evidence demonstrates HVA22A's role in programmed cell death?

Several experimental approaches have provided evidence for HVA22A's role in programmed cell death:

  • Overexpression studies: When HVA22 was overexpressed in barley aleurone cells and treated with 1 μM GA for 48 hours, only around 30% of observed cells were vacuolated, compared to more than 80% in control cells .

  • Specificity testing: This inhibition was specific to HVA22, as overexpression of another ABA-induced protein (HVA1) or GFP did not inhibit GA-induced vacuolation .

  • GAMyb interaction: Overexpression of GAMyb resulted in approximately 80% vacuolated cells without GA treatment, similar to GA treatment alone. When HVA22 was co-expressed with GAMyb, it inhibited GAMyb-induced vacuolation by 40% .

  • RNAi experiments: Using HVA22RNAi to block HVA22 function abolished its inhibitory effect on GA-induced vacuolation, confirming the specificity of HVA22's action .

What expression systems are optimal for producing recombinant HVA22A?

Based on available data, E. coli expression systems have been successfully used to produce recombinant HVA22A:

  • Expression construct: The full-length protein (1-177aa) can be expressed with an N-terminal His tag for purification purposes .

  • Purification quality: Using appropriate purification techniques, recombinant HVA22A can be isolated with greater than 90% purity as determined by SDS-PAGE .

  • Protein yields: While specific yield data is not provided in the search results, the successful expression in E. coli suggests adequate protein production for research applications .

  • Alternative systems: For applications requiring post-translational modifications or studying protein interactions in a more native context, researchers might consider:

    • Plant-based expression systems (e.g., Nicotiana benthamiana transient expression)

    • Yeast expression systems for membrane proteins

    • Cell-free protein synthesis systems

What techniques are most effective for studying HVA22A localization and trafficking?

Several complementary approaches can be used to study HVA22A localization and trafficking:

  • Fluorescent protein fusions: HVA22:GFP fusion proteins have successfully revealed network and punctate fluorescence patterns corresponding to ER and Golgi localization .

  • Colocalization studies: Dual labeling with organelle markers like BiP:RFP (ER) and ST:mRFP (Golgi) has confirmed HVA22A's subcellular locations .

  • Live cell imaging: Time-lapse confocal microscopy with fluorescently tagged HVA22A can track protein movement and dynamics.

  • Domain mutation analysis: Studies have shown that transmembrane domain 2 is critical for HVA22A localization and stability .

  • Electron microscopy: Immunogold labeling can provide higher resolution localization data at the ultrastructural level.

How can researchers design effective functional assays for HVA22A?

To study HVA22A's functional roles, researchers can utilize several approaches:

  • Vacuolation assays in aleurone cells:

    • Transform cells to overexpress or knock down HVA22A

    • Treat with hormones (GA ± ABA)

    • Visualize vacuole formation using fluorescent markers like DesRed

    • Quantify percentage of cells showing vacuolation

  • Protein-protein interaction assays:

    • Split-ubiquitin membrane yeast two-hybrid system for membrane proteins

    • Bimolecular fluorescence complementation (BiFC) in planta

    • Co-immunoprecipitation with membrane solubilization

  • Viral interaction studies:

    • Monitor viral propagation rates in the presence/absence of HVA22A

    • Use deletion mutants to map interaction domains (e.g., C-terminal tail)

  • Genetic manipulation:

    • RNAi or CRISPR-based gene editing to reduce/eliminate HVA22A expression

    • Complementation with wild-type or mutated versions

    • Observe phenotypic effects on development, stress responses, or seed dormancy

How does the cellular localization of HVA22A relate to its function in vesicular trafficking?

The specific localization of HVA22A to the ER and Golgi apparatus provides important insights into its functional mechanisms:

  • Membrane network involvement: HVA22A shows network fluorescence patterns coinciding with ER markers and punctate patterns matching Golgi markers, positioning it within the secretory pathway .

  • Vesicle formation role: Based on structural similarity to yeast Yop1p, HVA22A may influence membrane curvature and vesicle formation at these organelles .

  • Traffic regulation points: By localizing to key organelles in the secretory pathway, HVA22A is positioned to regulate the transport of cargo proteins, potentially including hydrolytic enzymes in aleurone cells .

  • Trafficking inhibition mechanism: HVA22A appears to inhibit vesicular trafficking involved in nutrient mobilization, possibly by affecting vesicle budding, transport, or fusion at ER or Golgi membranes .

  • Viral replication connection: The interaction with viral protein 6K2 at viral replication compartments suggests HVA22A's involvement in membrane reorganization during viral infection .

What is the mechanism by which HVA22A inhibits GA-induced programmed cell death?

The mechanism of HVA22A's inhibition of GA-induced PCD involves several coordinated processes:

  • Signaling pathway position: HVA22A acts downstream of the GAMyb transcription factor in the GA signaling pathway. GAMyb activates PCD and other GA-mediated processes, while HVA22A counteracts specifically the PCD aspect .

  • Vacuolation inhibition: HVA22A prevents the GA-induced formation of large digestive vacuoles from protein storage vacuoles (PSVs). In cells overexpressing HVA22A, most cells retain small PSVs even after GA treatment .

  • Vesicular trafficking regulation: Based on HVA22A's localization to ER and Golgi apparatus, it likely inhibits vesicular trafficking processes involved in vacuole fusion or enlargement .

  • Specificity of action: The inhibition is specific to HVA22A, as overexpression of other ABA-induced proteins like HVA1 doesn't produce the same effect .

  • Relationship to ABA: ABA likely induces HVA22A accumulation to inhibit vesicular trafficking involved in nutrient mobilization during seed development, delaying PSV coalescence and maintaining dormancy .

How does AtHVA22a facilitate viral propagation and what does this reveal about its cellular functions?

The interaction between AtHVA22a and viral proteins provides insights into both viral strategies and the protein's normal cellular functions:

  • Viral interaction partner: AtHVA22a interacts with the 6K2 protein of turnip mosaic virus (TuMV), a potyviral protein involved in viral replication and cell-to-cell movement .

  • Interaction location: The interaction occurs at viral replication compartments during TuMV infection, suggesting involvement in viral replication complex formation .

  • Functional effect: AtHVA22a plays an agonistic (promoting) effect on TuMV propagation, indicating that the virus hijacks this cellular protein to enhance its replication .

  • Domain specificity: The C-terminal tail of AtHVA22a is particularly important for its role in viral propagation, suggesting a specific interaction interface or functional domain .

  • Connection to normal function: This viral interaction suggests that AtHVA22a's normal role in membrane trafficking and organization is subverted by the virus to create or maintain viral replication sites .

  • Plasmodesmata enrichment: AtHVA22a is highly enriched in plasmodesmata (PD) proteome, which may explain how it contributes to cell-to-cell movement of the virus .

What proteins are known to interact with HVA22A and how are these interactions studied?

Current knowledge about HVA22A protein interactions is limited but growing:

  • Confirmed interactions:

    • TuMV 6K2 protein: Interacts with AtHVA22a at viral replication compartments

  • Methods used to identify interactions:

    • Split-ubiquitin membrane yeast two-hybrid system - specifically designed for membrane proteins

    • Bimolecular fluorescence complementation (BiFC) in planta - confirms interaction in native context

    • Subcellular colocalization - demonstrates spatial coincidence of interacting partners

  • Potential interactions based on function:

    • Components of vesicular trafficking machinery

    • Proteins involved in ABA and GA signaling pathways

    • Membrane remodeling factors

  • Recommended screening approaches:

    • Proteomics of immunoprecipitated complexes

    • Proximity labeling techniques (BioID/TurboID)

    • Membrane-specific interactome analyses

How do genetic approaches help elucidate HVA22A function in planta?

Genetic manipulation provides powerful tools for understanding HVA22A's functions:

  • Gene silencing approaches:

    • HVA22RNAi constructs effectively silenced HVA22A expression

    • RNAi eliminated the inhibitory effect of overexpressed HVA22A on GA-induced vacuolation

    • Interestingly, HVA22RNAi could not block ABA's inhibition of GA-induced PCD, suggesting redundancy or parallel pathways

  • Overexpression studies:

    • Overexpression of HVA22A inhibited GA-induced vacuolation

    • Overexpression inhibited GAMyb-induced vacuolation by 40%

    • Expression driven by the maize ubiquitin promoter was effective

  • Domain analysis:

    • Transmembrane domain 2, particularly, is critical for protein localization and stability

    • The C-terminal tail is important for viral interaction and propagation

  • Developmental analysis:

    • HVA22A expression correlates with seed dormancy status

    • Transcripts degrade within 12 hours after imbibition in non-dormant seeds

    • Levels remain high in dormant grains

What cross-species functional conservation exists among HVA22 homologs?

HVA22 proteins show notable conservation across species with some functional specialization:

  • Arabidopsis-barley conservation:

    • AtHVA22D shows similar function to barley HVA22 in inhibiting vacuolation

    • This indicates functional conservation between these homologs

  • Structural conservation:

    • HVA22 homologs share high amino acid sequence similarity in the conserved TB2/DP1 domain

    • Plant HVA22 proteins contain structures similar to yeast Yop1p, with a characteristic membrane topology

  • Evolutionary distribution:

    • 354 HVA22 homologs exist across diverse eukaryotes

    • Present in plants, mosses, yeast, and mammals

    • Absent in prokaryotes, suggesting eukaryote-specific functions

  • Functional specialization:

    • AtHVA22a appears enriched in plasmodesmata and interacts with viral proteins

    • Different homologs may have specialized in different cellular processes while maintaining core membrane-related functions

How can researchers use recombinant HVA22A to study plant hormone crosstalk?

Recombinant HVA22A offers valuable opportunities to investigate hormone signaling interactions:

  • Experimental approaches:

    • In vitro binding assays to identify direct interactions with hormone signaling components

    • Structure-function analyses to map domains involved in hormone-responsive regulation

    • Interactome studies in hormone-treated vs. untreated conditions

  • Signaling pathway position:

    • HVA22A functions downstream of GAMyb in GA signaling

    • It's induced by ABA signaling

    • This positions it at a critical junction in ABA-GA crosstalk

  • Mechanistic studies:

    • Investigate if HVA22A directly affects protein trafficking of hormone signaling components

    • Determine if post-translational modifications affect HVA22A function in response to hormones

    • Examine if HVA22A serves as a direct target for hormone-regulated protein degradation

  • Developmental context:

    • Study HVA22A's role in developmental transitions regulated by ABA/GA balance

    • Investigate tissue-specific responses to hormone fluctuations during development

What are the implications of HVA22A's role in viral propagation for plant-pathogen interactions?

The discovery that AtHVA22a facilitates viral propagation opens new research directions:

  • Mechanism of viral facilitation:

    • Investigate whether AtHVA22a contributes to viral replication complex formation

    • Determine if it facilitates viral movement through plasmodesmata

    • Examine if it shields viral components from host defense mechanisms

  • Potential applications:

    • Engineering HVA22A mutants resistant to viral hijacking

    • Using HVA22A as a target for developing viral resistance strategies

    • Studying HVA22A interactions with different viral proteins to understand host range

  • Evolutionary considerations:

    • Compare HVA22 proteins across species for correlation with viral susceptibility

    • Investigate if viral pressure has driven HVA22 evolution in different plant lineages

  • Broader pathogen interactions:

    • Explore potential roles of HVA22A in other plant-pathogen interactions

    • Investigate if bacterial or fungal pathogens also target HVA22A

What methodological challenges exist in studying membrane proteins like HVA22A and how can they be addressed?

Working with membrane proteins presents specific technical challenges:

  • Protein expression and purification:

    • Challenge: Maintaining proper folding and membrane insertion

    • Solution: Use specialized expression systems (insect cells, cell-free systems) or detergent optimization

  • Structural studies:

    • Challenge: Obtaining sufficient protein for crystallography or cryo-EM

    • Solution: Consider lipid nanodiscs, amphipols, or membrane mimetics to stabilize protein

  • Protein-protein interactions:

    • Challenge: Preserving membrane context during interaction studies

    • Solution: Use membrane-specific approaches like split-ubiquitin yeast two-hybrid or proximity labeling

  • Functional assays:

    • Challenge: Maintaining native membrane environment for functional studies

    • Solution: Liposome reconstitution or semi-intact cell systems

  • Imaging approaches:

    • Challenge: Distinguishing specific localization in membrane compartments

    • Solution: Super-resolution microscopy or correlative light and electron microscopy

How do the different HVA22 homologs in Arabidopsis compare functionally?

Arabidopsis contains multiple HVA22 homologs with potentially specialized functions:

  • AtHVA22a:

    • Enriched in plasmodesmata proteome

    • Interacts with turnip mosaic virus 6K2 protein

    • Plays an agonistic role in TuMV propagation

    • The C-terminal tail is important for viral interactions

  • AtHVA22D:

    • Functionally similar to barley HVA22

    • Inhibits vacuolation at similar levels to barley HVA22

    • Indicates conservation of function in regulating programmed cell death

  • Comparative analysis:

    • Different homologs likely emerged through gene duplication

    • May have evolved specialized functions in different tissues or stress responses

    • Potential functional redundancy explains why HVA22RNAi couldn't block ABA's inhibition of GA-induced PCD

What factors should researchers consider when selecting between HVA22 homologs for specific studies?

When choosing which HVA22 homolog to study, researchers should consider:

  • Expression patterns:

    • Tissue specificity

    • Developmental regulation

    • Stress-responsive expression profiles

  • Subcellular localization:

    • AtHVA22a is enriched in plasmodesmata

    • Other homologs may have distinct distributions within the endomembrane system

  • Functional specialization:

    • AtHVA22a's role in viral interactions

    • AtHVA22D's similarity to barley HVA22 in vacuolation inhibition

  • Experimental context:

    • The specific biological process under investigation

    • Available tools and reagents for each homolog

    • Known interacting partners relevant to the research question

  • Evolutionary conservation:

    • Sequence conservation with homologs in other species

    • Presence of specific domains or motifs of interest

Key properties of recombinant HVA22A protein

PropertyDetails
Full protein length177 amino acids
UniProt IDQ9S7V4
Gene nameHVA22A
SynonymsAt1g74520; F1M20.20; HVA22-like protein a; AtHVA22a
Expression systemE. coli
TagN-terminal His tag
Purity>90% by SDS-PAGE
FormLyophilized powder
Storage bufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Optimal storage-20°C/-80°C, avoid repeated freeze-thaw cycles

Comparison of experimental approaches for studying HVA22A function

Research QuestionRecommended MethodsKey Considerations
Protein localizationFluorescent protein fusions, Organelle colocalization, Electron microscopyTransmembrane domain 2 is critical for localization and stability
Protein-protein interactionsSplit-ubiquitin membrane Y2H, BiFC in planta, Co-IP with membrane solubilizationMust preserve membrane environment for valid results
Role in programmed cell deathVacuolation assays in aleurone cells, GA treatment with/without protein overexpressionQuantify percentage of cells showing vacuolation
Viral interactionsViral propagation assays, Domain mapping, Colocalization with viral compartmentsC-terminal tail is particularly important
Hormone responsesExpression analysis under hormone treatments, Genetic manipulation studiesConsider position downstream of GAMyb in signaling pathway

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.