Recombinant Arabidopsis thaliana HVA22-like protein b (HVA22B)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for custom preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
HVA22B; At5g62490; K19B1.10; HVA22-like protein b; AtHVA22b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
HVA22B
Target Protein Sequence
MSSGIGSLVKVIFKNFDVIAGPVISLVYPLYASVRAIESRSHGDDKQWLTYWALYSLIKL FELTFFRLLEWIPLYPYAKLALTSWLVLPGMNGAAYLYEHYVRSFLLSPHTVNVWYVPAK KDDDLGATAGKFTPVNDSGAPQEKIVSSVDTSAKYVGHSAFDDAYIY
Uniprot No.

Target Background

Database Links

KEGG: ath:AT5G62490

STRING: 3702.AT5G62490.1

UniGene: At.9305

Protein Families
DP1 family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Predominantly expressed in flower buds.

Q&A

What is HVA22B and how is it related to other HVA22 family proteins?

HVA22B (AtHVA22b) is one of five HVA22 homologues identified in Arabidopsis thaliana. These homologues are designated as AtHVA22a, b, c, d, and e, with AtHVA22b belonging to the first subfamily along with AtHVA22a and AtHVA22c. The second subfamily consists of AtHVA22d and AtHVA22e, which are phylogenetically closer to the original barley HVA22 than the first subfamily. This phylogenetic distribution suggests that the two subfamilies diverged before the evolutionary split between monocots and dicots . The HVA22 gene family is highly conserved across plants, animals, fungi, and protozoa, but notably absent in prokaryotes, indicating its unique and essential role in eukaryotic cellular functions .

How is AtHVA22B gene expression regulated in response to environmental stresses?

AtHVA22B expression is differentially regulated by various environmental stresses. Specifically, abscisic acid (ABA) and salt stress induce AtHVA22B expression, while cold stress has been shown to suppress ABA-induced expression of this gene . This pattern differs from other family members; for instance, AtHVA22a, d, and e show enhanced expression in response to ABA, cold, dehydration, and salt stresses, while AtHVA22c shows minimal or even suppressive responses to these same stressors . These differential expression patterns suggest specialized roles for each family member in stress adaptation mechanisms.

What are the optimal conditions for storing and reconstituting recombinant AtHVA22B protein?

For optimal storage and reconstitution of recombinant AtHVA22B, researchers should follow these evidence-based protocols:

ParameterRecommended Condition
Long-term storage-20°C to -80°C, aliquoted to prevent freeze-thaw cycles
Buffer compositionTris/PBS-based buffer with 6% Trehalose, pH 8.0
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL
Working storageAdd glycerol to 5-50% final concentration for -20°C storage
Short-term usageWorking aliquots at 4°C for up to one week

It is critical to minimize repeated freeze-thaw cycles as these significantly reduce protein activity. Before opening, the vial should be briefly centrifuged to bring contents to the bottom . For experimental reproducibility, the protein purity should be verified (generally >90% as determined by SDS-PAGE) before use in functional studies .

What expression systems are most effective for producing functional recombinant AtHVA22B?

For studies requiring native protein conformation and modifications, plant-based expression systems may be preferable, although these typically yield lower protein quantities. When designing expression constructs, researchers should note that the transmembrane domains of HVA22 proteins are critical for proper localization and stability, particularly transmembrane domain 2, which has been shown to be essential for protein localization to the ER and Golgi apparatus in related HVA22 proteins .

How can researchers effectively validate the function of AtHVA22B in planta?

Validating AtHVA22B function in plants requires multiple complementary approaches:

  • Transgenic overexpression: Generate Arabidopsis lines overexpressing AtHVA22B under constitutive (e.g., 35S) or inducible promoters to assess gain-of-function phenotypes.

  • RNA interference (RNAi) or CRISPR-Cas9 knockout: RNAi targeting the conserved TB2/DP1 domain (approximately 300 bp) has been shown effective for HVA22 family proteins . CRISPR-based approaches provide more precise gene inactivation.

  • Subcellular localization: Creating HVA22B:GFP fusion proteins allows visualization of protein localization. Previous studies with related HVA22 proteins have shown localization to the ER and Golgi apparatus, which can be confirmed using co-localization with established markers such as BiP:RFP (ER) and ST:mRFP (Golgi) .

  • Stress response assays: Expose transgenic plants to various stresses (ABA treatment, salt, drought, cold) and assess phenotypic differences compared to wild-type plants, particularly focusing on germination rates, seedling development, and stress tolerance .

  • Protein-protein interaction studies: Yeast two-hybrid, co-immunoprecipitation, or bimolecular fluorescence complementation (BiFC) can identify interaction partners, providing insights into functional pathways.

How does AtHVA22B function in the ABA signaling pathway and stress responses?

AtHVA22B functions as a downstream regulator in the ABA signaling pathway, potentially modulating vesicular trafficking processes during stress responses. Based on studies of HVA22 homologs, it likely inhibits GA-induced formation of digestive vacuoles, which is an important aspect of programmed cell death (PCD) . Mechanistically, HVA22B appears to act downstream of the transcription factor GAMyb, which activates PCD and other GA-mediated processes .

The specific role of AtHVA22B in stress tolerance appears to be related to its ability to regulate membrane dynamics and vesicular trafficking. Under stress conditions, ABA induces HVA22B expression, which then helps maintain cellular homeostasis by regulating vesicle-mediated processes. This function is particularly important during seed development and germination, where it may help delay programmed cell death until favorable conditions for seedling establishment are present .

For researchers investigating this pathway, it's important to note that while HVA22 proteins contribute to ABA-mediated inhibition of GA responses, they are not absolutely required for this process. Studies using RNA interference to knock down HVA22 expression found that ABA could still inhibit GA-induced PCD in the absence of HVA22, suggesting redundant mechanisms in this regulatory pathway .

What is the relationship between AtHVA22B localization and its cellular function?

AtHVA22B primarily localizes to the endoplasmic reticulum (ER) and Golgi apparatus, which is crucial for its role in vesicular trafficking and stress responses. Studies using HVA22:GFP fusion proteins have revealed network and punctate fluorescence patterns that co-localize with ER and Golgi markers .

The transmembrane domains of HVA22B are particularly important for this localization pattern. The second transmembrane domain has been shown to be critical for both protein localization and stability . This localization at the interface of ER and Golgi suggests that AtHVA22B may function in regulating protein and vesicle trafficking between these organelles, particularly during stress responses.

Functionally, this localization allows HVA22B to inhibit vesicular trafficking involved in nutrient mobilization, potentially delaying the coalescence of protein storage vacuoles. This action is part of ABA's role in regulating seed germination and seedling growth under adverse conditions . For researchers, this relationship between localization and function offers potential targets for modifying plant stress responses by altering HVA22B trafficking or localization patterns.

How do the functions of AtHVA22B differ from other Arabidopsis HVA22 homologs?

The five Arabidopsis HVA22 homologs show distinct expression patterns and likely fulfill different physiological roles:

HomologStress ResponseTissue ExpressionPotential Function
AtHVA22aEnhanced by ABA, cold, dehydration, saltHigher in flower buds and inflorescence stemsStress tolerance
AtHVA22bInduced by ABA and salt; cold suppresses ABA inductionHigher in reproductive tissuesReproductive development
AtHVA22cMinimal or suppressive response to stressVariableUnknown, potentially developmental
AtHVA22dStrongly regulated by ABA, cold, dehydration, saltHigher in reproductive tissuesStress tolerance
AtHVA22eEnhanced by ABA, cold, dehydration, saltHigher in reproductive tissuesStress tolerance

AtHVA22B appears to be more specialized for reproductive development, while maintaining some stress-responsive characteristics. In contrast, AtHVA22d and AtHVA22e show stronger homology to barley HVA22 and are more broadly responsive to diverse stresses . Importantly, AtHVA22d has been demonstrated to functionally substitute for barley HVA22 in inhibiting GA-mediated vacuolation/programmed cell death, suggesting a conservation of function across species .

Researchers should consider these functional differences when designing experiments or selecting specific homologs for targeted studies. The differential regulation of these homologs suggests they may have evolved specialized functions to address different aspects of plant development and stress response.

How can AtHVA22B research contribute to understanding stress adaptation in crop plants?

Research on AtHVA22B offers significant implications for crop improvement strategies, particularly for enhancing stress tolerance. The ancestral divergence of HVA22 homologs before the separation of monocots and dicots suggests that findings from Arabidopsis can be transferred to important crop species . Since HVA22 proteins regulate critical processes like vesicular trafficking and programmed cell death in response to stress hormones, manipulating these pathways could enhance crop resilience to drought, salinity, and temperature extremes.

Specifically, the antagonistic relationship between ABA (inducing HVA22B) and GA signaling pathways presents an opportunity to fine-tune stress responses and growth tradeoffs in crops. By altering the expression or activity of HVA22B homologs, researchers might be able to enhance stress tolerance without severely compromising yield under optimal conditions. The role of HVA22 proteins in delaying programmed cell death during stress could potentially be harnessed to extend grain-filling periods under drought or maintain photosynthetic capacity during environmental challenges .

What are the contradictions in the current understanding of AtHVA22B function?

Several contradictions and knowledge gaps exist in our current understanding of AtHVA22B function:

  • Necessity in ABA signaling: While HVA22 proteins are highly induced by ABA and can inhibit GA-induced processes, RNAi experiments suggest they are not absolutely required for ABA-mediated inhibition of programmed cell death . This contradicts the expected essential role and suggests unknown redundant pathways.

  • Subfamily functional divergence: Despite phylogenetic analysis suggesting functional divergence between the two AtHVA22 subfamilies (a,b,c versus d,e), experimental evidence directly comparing their biochemical activities is limited . It remains unclear whether the structural differences translate to distinct cellular mechanisms.

  • Tissue-specific functions: While expression data show higher levels of AtHVA22B in reproductive tissues compared to vegetative tissues, the specific developmental processes it regulates remain poorly characterized . The functional significance of this expression pattern requires further investigation.

  • Stress-specific responses: AtHVA22B shows an unusual pattern of being induced by ABA and salt but suppressed by cold stress during ABA induction . This contradictory response to different stresses suggests complex regulatory mechanisms that aren't fully understood.

Researchers addressing these contradictions should design experiments that directly compare the biochemical activities of different homologs, investigate potential redundancy in ABA signaling pathways, and perform detailed analyses of tissue-specific functions during development and stress.

What methodological approaches can resolve current controversies in AtHVA22B research?

To address current controversies and knowledge gaps in AtHVA22B research, investigators should consider these methodological approaches:

  • Comparative interactomics: Perform systematic protein-protein interaction studies across all five AtHVA22 homologs to identify both shared and unique interaction partners. This would help delineate their potentially overlapping and distinct functions in cellular pathways.

  • Multi-omics integration: Combine transcriptomics, proteomics, and metabolomics approaches in AtHVA22B overexpression and knockout lines under various stress conditions to build comprehensive pathway models.

  • Real-time imaging: Employ advanced live-cell imaging techniques with fluorescently-tagged proteins to visualize HVA22B dynamics during stress responses and developmental transitions. This could resolve questions about its real-time movement between cellular compartments.

  • CRISPR-based multiplexing: Generate combinatorial knockouts of multiple AtHVA22 family members to systematically address questions of functional redundancy that have been suggested by RNAi experiments showing that HVA22 is not absolutely required for ABA-mediated inhibition of PCD .

  • Structure-function analysis: Perform detailed mutagenesis of key domains, particularly transmembrane domains and the TB2/DP1 domain, to correlate protein structure with specific cellular functions and localization patterns .

  • Heterologous expression studies: Express AtHVA22B in diverse plant species, particularly crops, to determine the conservation of function across evolutionarily distant plants, which would validate its potential utility in agricultural applications.

What are common challenges in working with recombinant AtHVA22B and how can they be addressed?

Researchers working with recombinant AtHVA22B often encounter several technical challenges:

  • Protein solubility issues: As a membrane-associated protein with transmembrane domains, AtHVA22B can exhibit poor solubility when expressed recombinantly.

    • Solution: Optimize extraction buffers with mild detergents (0.1-1% Triton X-100 or n-dodecyl β-D-maltoside) and extract at 4°C to maintain native conformation.

  • Low expression yields: Expression levels in E. coli systems may be lower than desired.

    • Solution: Consider using specialized E. coli strains designed for membrane protein expression (e.g., C41(DE3) or C43(DE3)), or optimize codon usage for the expression system .

  • Protein degradation: Rapid degradation during purification or storage can limit experimental applications.

    • Solution: Include protease inhibitors during extraction and purification, maintain samples at 4°C during processing, and store with glycerol (5-50%) in aliquots at -20°C or -80°C to prevent freeze-thaw damage .

  • Functional validation: Confirming that the recombinant protein retains native activity can be challenging.

    • Solution: Compare the activity of the recombinant protein to that of the native protein in vesicle trafficking assays or through complementation of mutant phenotypes in planta.

  • Protein-protein interaction artifacts: False positives in interaction studies due to hydrophobic transmembrane domains.

    • Solution: Include appropriate negative controls and validate interactions through multiple independent methods (Y2H, co-IP, BiFC, etc.).

How can functional assays be designed to assess AtHVA22B activity in vitro?

Designing functional assays for AtHVA22B requires consideration of its cellular localization and proposed functions in vesicular trafficking. Here are methodological approaches for in vitro assessment:

  • Vesicle budding/fusion assays:

    • Prepare microsomal fractions from plant tissues expressing AtHVA22B or from reconstituted systems.

    • Label vesicles with fluorescent markers (e.g., FM4-64).

    • Measure rates of vesicle formation or fusion in the presence or absence of purified recombinant AtHVA22B.

    • Include positive controls (known vesicle trafficking proteins) and negative controls (denatured protein).

  • Protein trafficking inhibition assay:

    • Establish an in vitro system using isolated ER and Golgi fractions.

    • Monitor the movement of model cargo proteins between compartments.

    • Assess whether recombinant AtHVA22B alters trafficking rates or directionality.

  • Lipid binding assays:

    • Use lipid overlay assays or liposome binding assays to determine if AtHVA22B interacts directly with specific membrane lipids.

    • This can provide insight into how the protein associates with cellular membranes.

  • GA/ABA hormone response assays:

    • Design cell-free systems containing components of GA and ABA signaling pathways.

    • Assess whether the addition of recombinant AtHVA22B alters signaling outputs in response to hormones.

    • This could include measuring phosphorylation of signaling components or DNA binding by transcription factors.

What are promising future research directions for AtHVA22B?

Based on current understanding and knowledge gaps, several promising research directions for AtHVA22B include:

  • Structural biology approaches: Determining the three-dimensional structure of AtHVA22B through X-ray crystallography or cryo-electron microscopy would provide critical insights into its mechanism of action and potential interaction surfaces.

  • Comparative analysis across species: Expanding the functional characterization of HVA22B homologs in crop species could reveal evolutionary adaptations to different stress environments and identify conserved functional domains.

  • Synthetic biology applications: Engineering modified HVA22B variants with enhanced or novel functions could lead to improved stress tolerance in transgenic crops without the yield penalties often associated with constitutive stress response activation.

  • Integration with other hormone signaling networks: Investigating how AtHVA22B interacts with signaling components beyond ABA and GA, particularly ethylene and auxin pathways which are also implicated in stress responses and senescence .

  • Single-cell resolution studies: Employing single-cell RNA-seq and proteomics approaches to understand cell-type specific functions of AtHVA22B, particularly in complex tissues with heterogeneous cell populations.

These research directions would address current knowledge gaps while potentially opening new avenues for agricultural applications in stress-tolerant crop development.

How can our understanding of AtHVA22B contribute to sustainable agriculture?

The mechanistic understanding of AtHVA22B functions offers several potential applications for sustainable agriculture:

  • Enhanced drought tolerance: Modulating HVA22B expression in crops could improve water-use efficiency and survival during drought periods by optimizing ABA responses and delaying stress-induced programmed cell death.

  • Improved seedling establishment: Since HVA22B plays a role in regulating seed germination and early seedling growth under stress conditions , fine-tuning its expression could lead to more consistent crop establishment in variable environments.

  • Extended grain-filling periods: The role of HVA22 proteins in delaying programmed cell death suggests that optimized expression could potentially extend grain-filling periods under terminal drought conditions, leading to improved yield stability.

  • Reduced yield penalties: Understanding the precise mechanisms by which HVA22B mediates stress responses without absolutely inhibiting growth processes could lead to targeted genetic modifications that enhance stress tolerance with minimal impact on yield potential.

  • Marker-assisted breeding: Identifying natural variants of HVA22B in crop germplasm collections could provide molecular markers for breeding programs targeting improved stress resilience.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.