Recombinant Arabidopsis thaliana HVA22-like protein c (HVA22C)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
HVA22C; At1g69700; T6C23.10; HVA22-like protein c; AtHVA22c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-184
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
HVA22C
Target Protein Sequence
MPSNSGDDNVLQVLIKNFDVLALPLVTLVYPLYASVKAIETRSLPEDEQWLTYWVLYALI SLFELTFSKPLEWFPIWPYMKLFGICWLVLPQFNGAEHIYKHFIRPFYRDPQRATTKIWY VPHKKFNFFPKRDDDDILTAAEKYMEQHGTEAFERMIVKKDSYERGRSSRGINNHMIFDD DYRY
Uniprot No.

Target Background

Database Links

KEGG: ath:AT1G69700

STRING: 3702.AT1G69700.1

UniGene: At.23695

Protein Families
DP1 family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Predominantly expressed in flower buds and stem.

Q&A

What is the structure and function of HVA22C in Arabidopsis thaliana?

HVA22C belongs to the HVA22 gene family that encodes stress response proteins with a conserved TB2/DP1/HVA22 domain unique among eukaryotes. These proteins are characterized by their role in plant responses to abiotic stresses . HVA22 proteins help regulate vesicular transport in stressed cells and reduce non-essential secretion, which improves plant resistance to environmental stressors . In Arabidopsis, five HVA22 proteins have been identified, which can be classified into two subfamilies based on sequence similarity .

How do HVA22 proteins respond to different stress conditions in Arabidopsis?

HVA22 proteins in Arabidopsis (AtHVA22s) are up-regulated in response to various environmental stresses, including salinity, drought, cold, and exogenous ABA treatment . This upregulation pattern suggests that HVA22 proteins form part of the stress response mechanism. Research methodologies to study these responses typically include:

  • RT-qPCR analysis of gene expression under different stress treatments

  • RNA-seq for transcriptome-wide responses

  • Promoter analysis to identify stress-responsive elements

  • Protein expression and localization studies under stress conditions

Most HVA22 promoter sequences contain numerous stress-responsive elements, including drought response elements (MYB), defense and stress response elements (TC-rich repeats), and hormone response elements (ABRE, ERE, SARE) .

What techniques are used to produce recombinant HVA22C protein?

To produce recombinant HVA22C protein for research purposes, the following methodological approach is typically employed:

  • Gene Amplification: The HVA22C coding region is amplified from Arabidopsis genomic DNA or cDNA using PCR with specific primers.

  • Vector Construction: The amplified fragment is cloned into an expression vector, typically after double digestion with appropriate restriction enzymes.

  • Transformation: The recombinant vector is introduced into an expression system (commonly E. coli, yeast, or insect cells).

  • Protein Induction: Expression of the recombinant protein is induced under optimal conditions.

  • Purification: The protein is purified using affinity chromatography or other suitable methods.

  • Verification: The identity and purity of the recombinant protein are confirmed using techniques such as SDS-PAGE and Western blotting.

How can functional characterization of HVA22C be performed through transgenic approaches?

Functional characterization of HVA22C requires both overexpression and knockout/knockdown approaches to fully understand its role in stress responses:

Overexpression Methodology:

  • Amplify the complete coding sequence of HVA22C using KOD polymerase

  • Clone into a plant expression vector (e.g., pCAMBIA2300) under a constitutive promoter such as 35S

  • Transform Arabidopsis using the floral dip method

  • Select transformants on kanamycin-containing medium

  • Confirm transgene integration by PCR and expression levels by RT-qPCR

  • Evaluate stress tolerance through phenotypic analysis under controlled conditions

Knockdown/Knockout Methodology:

  • For VIGS (Virus-Induced Gene Silencing): Amplify a conserved fragment of HVA22C

  • Clone into a VIGS vector (similar to CLCrV used for cotton studies)

  • Transform the construct into Agrobacterium

  • Infect plants and confirm silencing efficiency by RT-qPCR

  • For CRISPR/Cas9: Design guide RNAs targeting HVA22C

  • Evaluate stress responses in the silenced/knockout plants

What is the relationship between HVA22C expression and plant stress tolerance metrics?

When investigating the relationship between HVA22C expression and stress tolerance, researchers should measure multiple physiological parameters:

ParameterMethodExpected Result in HVA22C OverexpressionExpected Result in HVA22C Knockdown
Root GrowthRoot length measurement under stressEnhanced root growth under stressReduced root growth under stress
Survival RateCounting surviving plants after stressHigher survival rateLower survival rate
Chlorophyll ContentSpectrophotometric analysisMaintained chlorophyll under stressReduced chlorophyll under stress
Lipid PeroxidationMDA content measurementLower MDA contentHigher MDA content
Antioxidant Enzyme ActivitySOD, POD, CAT assaysIncreased antioxidant enzyme activityDecreased antioxidant enzyme activity
ROS AccumulationDAB and NBT stainingReduced ROS accumulationIncreased ROS accumulation
Water Loss RateFresh weight measurementsSlower water lossFaster water loss

These measurements should be conducted at multiple time points during stress exposure to capture the dynamic response patterns .

How does HVA22C interact with the ABA signaling pathway during stress responses?

To investigate the interaction between HVA22C and the ABA signaling pathway, researchers can employ these methodologies:

  • Gene Expression Analysis: Examine HVA22C expression in ABA-insensitive mutants (abi1, abi2, etc.) and ABA biosynthesis mutants (aba1, aba2, etc.) under stress conditions

  • Yeast Two-Hybrid Assays: Identify protein-protein interactions between HVA22C and known components of the ABA signaling pathway

  • Co-Immunoprecipitation: Confirm in vivo protein interactions identified from Y2H screens

  • ChIP-seq Analysis: Determine if ABA-responsive transcription factors bind to the HVA22C promoter

  • Electrophoretic Mobility Shift Assay (EMSA): Verify binding of transcription factors to specific elements in the HVA22C promoter

  • Transcriptome Analysis: Compare gene expression profiles of wild-type and HVA22C overexpression/knockout lines in response to ABA treatment

Current research indicates that HVA22 genes contain numerous ABA-responsive elements (ABREs) in their promoters, suggesting direct regulation by the ABA signaling pathway .

What subcellular localization patterns does HVA22C exhibit during normal growth versus stress conditions?

To determine the subcellular localization of HVA22C:

  • Construct Generation: Create C-terminal or N-terminal fusions of HVA22C with fluorescent proteins (GFP, YFP)

  • Transient Expression: Perform transient expression in protoplasts or Nicotiana benthamiana leaves

  • Stable Transformation: Generate stable Arabidopsis transformants expressing the fusion proteins

  • Confocal Microscopy: Observe localization under normal and stress conditions (drought, salt, ABA treatment)

  • Co-localization Studies: Use organelle-specific markers to determine precise subcellular location

  • Subcellular Fractionation: Perform biochemical fractionation followed by Western blot analysis to confirm microscopy results

Based on studies of related HVA22 proteins, they may be involved in vesicular trafficking and can show dynamic localization patterns in response to stress .

How do post-translational modifications affect HVA22C function during stress responses?

Post-translational modifications often regulate protein function during stress responses. To investigate PTMs of HVA22C:

  • Mass Spectrometry: Identify phosphorylation, ubiquitination, SUMOylation, or other modifications

    • Express and purify recombinant HVA22C from plants under different stress conditions

    • Perform tryptic digestion and LC-MS/MS analysis

    • Compare PTM patterns between normal and stress conditions

  • Site-Directed Mutagenesis: Create point mutations at potential modification sites

    • Transform plants with mutated versions of HVA22C

    • Assess if mutations affect stress tolerance

    • Compare with wild-type HVA22C overexpression lines

  • In vitro Modification Assays: Test if HVA22C is a substrate for known kinases, E3 ligases, etc.

What are the best experimental controls when studying HVA22C function?

When designing experiments to study HVA22C function, several controls should be included:

  • Empty Vector Controls: Plants transformed with the same vector but without the HVA22C gene

  • Wild-Type Controls: Non-transformed plants of the same ecotype

  • Related Gene Controls: Plants overexpressing other HVA22 family members to assess specificity

  • Complementation Controls: For knockout studies, include lines where the gene function is restored

  • Stress Treatment Controls: Include both stressed and non-stressed conditions

  • Time-Course Sampling: Collect samples at multiple time points to capture dynamic responses

  • Tissue-Specific Analysis: Examine responses in different plant tissues (roots, leaves, etc.)

How can researchers troubleshoot common issues in HVA22C protein expression systems?

When expressing recombinant HVA22C protein, researchers may encounter several challenges:

IssuePossible CauseTroubleshooting Strategy
Low ExpressionCodon bias, toxic to hostOptimize codons, use different host strains, reduce induction temperature
Insoluble ProteinImproper foldingExpress as fusion with solubility tags (MBP, SUMO), optimize buffer conditions
DegradationProteolytic activityAdd protease inhibitors, use protease-deficient strains
Low PurityNon-specific bindingOptimize washing steps, use tandem purification tags
Loss of ActivityDenaturation during purificationMaintain cold temperature, add stabilizing agents

What bioinformatic approaches can reveal novel insights about HVA22C function?

Computational approaches can provide valuable insights into HVA22C function:

  • Sequence Analysis: Multiple sequence alignment of HVA22 proteins across species can identify conserved domains and critical residues

  • Phylogenetic Analysis: Construction of phylogenetic trees to understand evolutionary relationships and potential functional divergence among HVA22 family members

  • Promoter Analysis: Identification of cis-regulatory elements to predict stress-responsive expression patterns

  • Protein Structure Prediction: Homology modeling to predict 3D structure and functional sites

  • Co-expression Network Analysis: Identification of genes with similar expression patterns to infer functional relationships

  • Protein-Protein Interaction Prediction: Computational prediction of interaction partners

  • Genome-Wide Association Studies: Correlation of natural variation in HVA22C with stress tolerance phenotypes

How do different HVA22 family members coordinate their functions during stress responses?

To investigate the coordinated functions of HVA22 family members:

  • Multiple Gene Knockouts: Generate double or triple mutants of different HVA22 genes

  • Expression Pattern Analysis: Compare spatial and temporal expression patterns of all family members under various stresses

  • Protein-Protein Interaction Studies: Determine if HVA22 proteins interact with each other or form complexes

  • Transcriptome Analysis: Compare transcriptional responses in single and multiple knockout mutants

  • Promoter Swap Experiments: Express HVA22C under the control of promoters from other family members to test functional redundancy

In Arabidopsis, five HVA22 genes have been identified and classified into different subfamilies based on sequence similarity , suggesting potential functional specialization.

What is the role of HVA22C in integrating responses to multiple simultaneous stresses?

Plants in nature often face multiple stresses simultaneously. To study how HVA22C functions under combined stresses:

  • Combined Stress Treatments: Subject plants to combinations of drought, salt, heat, and cold stresses

  • Comparative Physiology: Measure stress response parameters under single versus combined stresses

  • Hormone Cross-Talk Analysis: Examine how HVA22C responds to combinations of stress hormones (ABA, ethylene, JA)

  • Metabolomic Profiling: Compare metabolite changes in wild-type versus HVA22C-modified plants under combined stresses

  • Epigenetic Regulation: Investigate if combined stresses alter epigenetic marks at the HVA22C locus

Research has shown that HVA22 promoters contain multiple hormone response elements (ABRE, ERE, SARE) , suggesting potential integration of different stress signaling pathways.

What are the most effective phenotyping approaches to quantify HVA22C-mediated stress tolerance?

When phenotyping HVA22C-modified plants for stress tolerance, consider these approaches:

  • Controlled Growth Conditions: Use growth chambers or greenhouses with precise control of temperature, light, and humidity

  • Standardized Stress Application: Apply stress treatments uniformly, such as:

    • Drought: Withhold water for defined periods or use PEG/mannitol for osmotic stress

    • Salt: Apply precise NaCl concentrations

    • Cold: Expose to specific low temperatures for defined durations

  • High-Throughput Phenotyping: Employ automated imaging systems to monitor growth parameters

  • Statistical Design: Use appropriate randomization and sufficient biological replicates

  • Multiple Developmental Stages: Test stress responses at various growth stages

Based on previous studies with HVA22 proteins, researchers should monitor key parameters including:

  • Germination rate under stress conditions

  • Root length and architecture

  • Biomass accumulation

  • Photosynthetic efficiency

  • Survival rate after stress recovery

  • Yield components under stress

How can emerging technologies enhance our understanding of HVA22C function?

Several cutting-edge technologies can provide deeper insights into HVA22C function:

  • CRISPR-Cas9 Gene Editing: Generate precise mutations or regulatory element modifications

  • Single-Cell RNA-Seq: Examine cell-type specific expression patterns of HVA22C

  • Spatial Transcriptomics: Map HVA22C expression across different tissue regions

  • Cryo-EM: Determine high-resolution protein structure and complexes

  • Optogenetics: Control HVA22C activity with light to study temporal aspects of function

  • Proximity Labeling: Identify proteins in close proximity to HVA22C in vivo

  • Live Cell Imaging: Monitor dynamic changes in HVA22C localization during stress responses

  • Nanobody-Based Sensors: Develop sensors to monitor HVA22C conformational changes

These approaches can reveal spatial, temporal, and molecular details of HVA22C function that traditional methods cannot capture.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.