Recombinant Arabidopsis thaliana HVA22-like protein d (HVA22D)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Arabidopsis thaliana HVA22-like protein d (HVA22D)

Recombinant Arabidopsis thaliana HVA22-like protein d, commonly referred to as HVA22D, is a protein derived from the model plant Arabidopsis thaliana. This protein is part of the HVA22 family, which plays significant roles in plant responses to abiotic stresses and hormonal regulation. HVA22D is homologous to a barley gene that is induced by abscisic acid (ABA) and involved in stress responses and programmed cell death regulation.

Characteristics of HVA22D

  • Protein Structure and Function: HVA22D is a protein with specific structural features that allow it to interact with cellular components involved in stress responses and cellular regulation. It is localized in the endoplasmic reticulum (ER) and Golgi apparatus, similar to its barley counterpart, HVA22 .

  • Expression and Regulation: The expression of HVA22D is influenced by environmental stresses and hormonal signals. It is part of a larger family of genes that respond to drought, salt, and cold stresses, among others .

  • Production and Availability: Recombinant HVA22D is available in various forms, including full-length and partial proteins, produced in different expression systems such as yeast, E. coli, and mammalian cells .

Biological Roles of HVA22D

Research Findings and Applications

Protein FeatureDescription
SpeciesArabidopsis thaliana
Gene NameHVA22D
Locus NameAt4g24960
Expression Region1-135
FunctionStress response, programmed cell death regulation
Production SystemsYeast, E. coli, Mammalian cells
  • Drought and Salt Tolerance: Overexpression of HVA22-like proteins in other plants has improved tolerance to drought and salt, suggesting potential applications in breeding stress-resistant crops .

  • Genetic Studies: HVA22D is part of a larger gene family with conserved motifs and functions across different plant species, making it a valuable target for genetic studies on stress responses .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes; we will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped on standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference for your protocols.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If a specific tag is required, please inform us, and we will prioritize its inclusion in the production process.
Synonyms
HVA22D; At4g24960; F13M23.100; HVA22-like protein d; AtHVA22d
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-135
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
HVA22D
Target Protein Sequence
MDKFWTFLTALHSGAGPIVMLLYPLYASVIAMESTTKVDDEQWLAYWIIYSFLSLTELIL QSLIEWIPIWYTVKLVFVAWLVLPQFQGAAFIYNRVVREQFKKHGVLRSTHSKPTKPNIL HSIFPHREGHEAHSH
Uniprot No.

Target Background

Gene References Into Functions
  1. HVA22 homologs function as autophagy suppressors in both plants and yeast. PMID: 19151132
Database Links

KEGG: ath:AT4G24960

STRING: 3702.AT4G24960.1

UniGene: At.2642

Protein Families
DP1 family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Predominantly expressed in flower buds.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.