Recombinant Arabidopsis thaliana HVA22-like protein e (HVA22E)

Shipped with Ice Packs
In Stock

Description

Protein Structure and Composition

HVA22E is a relatively small protein consisting of 116 amino acids with the following sequence: "MTKLWTSLSALHSLAGPVVMLLYPLYASVIAIESPSKVDDEQWLAYWILYSFLTLSELILQSLLEWIPIWYTAKLVFVAWLVLPQFRGAAFIYNKVVREQFKKYGILKPKVEHQAE" . The protein contains the characteristic TB2/DP1/HVA22 conserved domain, which is a defining feature of this protein family. This domain is highly conserved across eukaryotic organisms but is notably absent in prokaryotes, suggesting its emergence later in evolutionary history .

The recombinant form of HVA22E is typically produced with an N-terminal histidine tag to facilitate purification and further biochemical studies . This modification allows for efficient isolation of the protein while maintaining its functional properties for research applications.

Genetic Information and Nomenclature

Within the Arabidopsis thaliana genome, HVA22E is identified by several designations:

Identifier TypeDesignation
Gene NameHVA22E
Locus IDAt5g50720
SynonymsMFB16.12, HVA22-like protein e, AtHVA22e
UniProt IDQ9FED2

The naming convention reflects its homology to the original HVA22 gene first discovered in barley (Hordeum vulgare L.), with the suffix "E" distinguishing it from other family members in Arabidopsis .

Expression Systems and Methodology

Recombinant HVA22E protein can be efficiently produced using Escherichia coli as an expression host . The full-length protein (amino acids 1-116) is expressed with an N-terminal histidine tag, which facilitates purification through affinity chromatography techniques . This bacterial expression system offers advantages in terms of yield, cost-effectiveness, and scalability for research applications.

The recombinant protein is typically supplied as a lyophilized powder with purity greater than 90% as determined by SDS-PAGE analysis . This high level of purity ensures reliable results in subsequent experimental applications.

Origin and Conservation

The HVA22 protein family derives its name from its first-identified member in Hordeum vulgare L. (barley) aleurone cells, where it was characterized as an abscisic acid (ABA)-induced gene . Subsequent genomic analyses have revealed that HVA22 proteins share high sequence similarity with human TB2/DP1 proteins, indicating remarkable evolutionary conservation across distant taxonomic groups .

This conservation suggests fundamental cellular functions that have been maintained throughout eukaryotic evolution. The presence of the TB2/DP1/HVA22 domain across diverse organisms underscores its biological significance in cellular processes.

Distribution Across Plant Species

Comprehensive genomic analyses have identified multiple HVA22 family members across various plant species:

Plant SpeciesNumber of HVA22 Genes Identified
Arabidopsis thaliana5
Solanum lycopersicum (Tomato)15
Citrus clementina6
Citrus sinensis6
Gossypium barbadense (Cotton)34
Gossypium hirsutum (Cotton)32
Gossypium arboreum (Cotton)16
Gossypium raimondii (Cotton)17

The considerable variation in gene number across species suggests differential expansion of this gene family, potentially reflecting adaptations to specific environmental challenges or genomic duplication events .

Cellular Functions

HVA22 proteins, including HVA22E, participate in several crucial cellular processes:

The primary function appears to be regulation of vesicular transport in stressed cells, which helps reduce non-essential secretion during stress conditions . This conservation of cellular resources likely contributes to enhanced survival under adverse conditions by prioritizing essential cellular functions.

In Arabidopsis, the HVA22 family members have distinct but overlapping functions. While AtHVA22d has been implicated in autophagy regulation and flower development, with its deletion leading to enhanced autophagy and impaired flower development, specific functions of AtHVA22e have been primarily associated with stress responses .

Stress Response Mechanisms

One of the most significant roles of HVA22 proteins is their involvement in plant responses to environmental stresses. Research has demonstrated that HVA22 genes are responsive to various abiotic stressors:

HVA22 genes in both barley and Arabidopsis thaliana show upregulation in response to salinity, drought, cold, and exogenous abscisic acid (ABA) treatment . This stress-responsive expression pattern suggests a protective function under adverse environmental conditions.

The specific mechanism by which HVA22E contributes to stress tolerance is still being elucidated, but evidence suggests it may involve altering the antioxidant capacity of plants . This would help mitigate oxidative damage that typically accompanies drought, salinity, and other abiotic stresses.

Promoter Elements and Transcriptional Regulation

Analysis of HVA22 gene promoters has revealed numerous stress-responsive regulatory elements, including:

  • Drought response elements (MYB)

  • Defense and stress response elements (TC-rich repeats)

  • Hormone response elements (ABRE, ERE, SARE)

The presence of these elements explains the inducibility of HVA22 genes under various stress conditions and hormonal treatments, providing insight into their transcriptional regulation mechanisms .

Transgenic Studies

Transgenic approaches have provided compelling evidence for the role of HVA22 proteins in stress tolerance. A notable example involves GhHVA22E1D, a HVA22 family member from cotton (Gossypium hirsutum):

Overexpression of GhHVA22E1D in Arabidopsis thaliana significantly enhanced salt and drought tolerance in the transgenic plants . This gain-of-function experiment demonstrates the capacity of HVA22 proteins to confer stress resilience when expressed at higher levels.

Complementary loss-of-function experiments using virus-induced gene silencing of GhHVA22E1D in cotton resulted in reduced tolerance to both salt and drought stresses . This reciprocal approach further confirms the protective role of HVA22 proteins against these common environmental stressors.

Expression Profiles Under Stress Conditions

Expression profiling studies have shown that most HVA22 genes in cotton (GhHVA22s) exhibit constitutive expression patterns under normal conditions but can be significantly upregulated in response to specific stresses . These findings suggest that while HVA22 proteins maintain basal functions during normal growth, their activity becomes particularly critical during periods of environmental stress.

Different HVA22 family members may show distinct expression patterns in response to specific stressors. For instance, in Zea mays (corn), ZmHVA22 is downregulated under high salt, simulated drought, and cold stress, but upregulated under high temperature stress, ethylene induction, and ABA treatment . This differential regulation suggests specialized roles for different family members.

Crop Improvement Strategies

The demonstrated roles of HVA22 proteins in stress tolerance make them attractive candidates for crop improvement strategies. Their involvement in drought and salt tolerance is particularly relevant given the increasing challenges posed by climate change and soil degradation in agricultural systems.

Genetic engineering approaches utilizing HVA22 genes could potentially develop crops with enhanced tolerance to abiotic stresses. This application is supported by experimental evidence showing improved stress tolerance in transgenic plants overexpressing HVA22 genes .

Stress Response Biomarkers

Given their responsiveness to various stresses, HVA22 genes could serve as molecular biomarkers for stress responses in plants. Monitoring their expression levels could provide valuable information about the physiological state of plants under different environmental conditions, potentially allowing for early intervention in agricultural settings.

Research Reagents and Tools

Recombinant HVA22E protein serves as a valuable reagent for various research applications, including:

  • Structure-function studies to elucidate molecular mechanisms

  • Generation of antibodies for protein detection and localization

  • Identification of interacting protein partners

  • In vitro assays to assess biochemical activities

The availability of highly purified recombinant protein facilitates these applications, advancing our understanding of plant stress biology .

Comparative Functional Analysis

Comparative studies across different HVA22 family members could reveal functional specialization and redundancy. Understanding the unique and overlapping functions of each family member would provide a more comprehensive picture of how these proteins collectively contribute to plant stress adaptation.

Field Applications and Translational Research

Translating laboratory findings to field applications represents an important future direction. Evaluating the performance of HVA22-modified crops under realistic field conditions would validate their potential for agricultural improvement and address potential unintended consequences of genetic modification.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement. We will then prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference point for your own preparations.
Shelf Life
The shelf life of the protein is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
HVA22E; At5g50720; MFB16.12; HVA22-like protein e; AtHVA22e
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-116
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
HVA22E
Target Protein Sequence
MTKLWTSLSALHSLAGPVVMLLYPLYASVIAIESPSKVDDEQWLAYWILYSFLTLSELIL QSLLEWIPIWYTAKLVFVAWLVLPQFRGAAFIYNKVVREQFKKYGILKPKVEHQAE
Uniprot No.

Target Background

Database Links

KEGG: ath:AT5G50720

STRING: 3702.AT5G50720.1

UniGene: At.7898

Protein Families
DP1 family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Predominantly expressed in stem.

Q&A

What is the HVA22 protein family and how does HVA22E fit within this classification?

The HVA22 protein family comprises plant-specific transmembrane proteins that are homologous to the Receptor expression-enhancing protein (Reep)/Deleted in polyposis (DP1)/Yop1 family proteins found in animals and yeast. HVA22 was first isolated from barley (Hordeum vulgare) aleurone cells as an abscisic acid (ABA)/stress-induced protein . In Arabidopsis thaliana, the HVA22 family includes multiple homologs, with HVA22E being one member of this multigenic family.

These proteins are widely distributed across eukaryotes, though their specific functions in plants remain incompletely characterized. Research has demonstrated that some members, like AtHVA22a, are enriched in plasmodesmata (PD) proteome fractions, suggesting potential roles in intercellular communication .

What cellular localization patterns are characteristic of HVA22 family proteins?

HVA22 family proteins typically display specific subcellular localization patterns that provide insights into their function. Studies using fluorescent protein fusions have revealed that HVA22 proteins localize to both network-like structures corresponding to the endoplasmic reticulum (ER) and punctate structures corresponding to the Golgi apparatus .

For experimental verification of localization, researchers commonly use:

  • HVA22:GFP fusion proteins co-expressed with established organelle markers

  • ER marker BiP:RFP which co-localizes with the network pattern

  • Golgi marker ST:mRFP which co-localizes with the punctate pattern

Transmembrane domains, particularly transmembrane domain 2, play critical roles in proper protein localization and stability . When designing recombinant HVA22E constructs, preservation of these domains is essential for maintaining native localization patterns.

How is HVA22E expression regulated in Arabidopsis thaliana?

Like other HVA22 family members, HVA22E expression is primarily regulated by phytohormones and environmental stress factors. Based on studies of related family members, HVA22E is likely induced by:

  • Abscisic acid (ABA) signaling pathways

  • Various abiotic stresses (drought, cold, salt)

  • Developmental cues during seed maturation and germination

The regulatory elements in the promoter region typically include ABA-responsive elements (ABREs) that mediate stress-induced transcriptional activation. When designing experiments to study HVA22E expression, researchers should consider these regulatory contexts and incorporate appropriate treatments to stimulate expression.

What are the recommended methods for producing recombinant HVA22E protein?

For efficient production of recombinant Arabidopsis thaliana HVA22E protein, researchers should consider the following methodological approach:

  • Expression System Selection:

    • Bacterial systems (E. coli) may be suitable for basic studies but often struggle with proper folding of transmembrane proteins

    • Yeast expression systems (P. pastoris) often provide better results for plant membrane proteins

    • Plant-based expression systems (N. benthamiana) offer the most native-like post-translational modifications

  • Construct Design Considerations:

    • Include appropriate affinity tags (His, GST, or FLAG) for purification

    • Consider fusion partners to enhance solubility

    • Preserve transmembrane domains critical for function

    • For membrane proteins, addition of solubilization tags may improve yield

  • Purification Strategy:

    • Use detergent screens to identify optimal solubilization conditions

    • Implement two-step purification protocols (affinity chromatography followed by size exclusion)

    • Consider native-PAGE techniques to assess protein complex formation

When validating recombinant protein activity, functional assays based on known HVA22 activities such as interaction with membrane remodeling machinery would be appropriate.

How can experimental design principles be optimized for HVA22E functional studies?

When designing experiments to study HVA22E function, researchers should implement rigorous experimental design principles to ensure robust and interpretable results:

  • Statistical Power Determination:

    • Pre-experiment power analysis to determine sample sizes needed to detect biologically relevant effects

    • Implementation of utility-based experimental design approaches as described in big data contexts

  • Appropriate Controls Selection:

    • Include both negative controls (vector-only, unrelated protein) and positive controls (known HVA22 family members with characterized functions)

    • Consider using closely related Arabidopsis HVA22 homologs (HVA22D) as functional comparators

  • Sequential Experimental Approaches:

    • Implement adaptive design principles where information from initial experiments informs subsequent experimental parameters

  • Data Acquisition Strategy:

    • For large-scale omics studies, employ principled subsampling approaches rather than random sampling

    • Balance between study breadth (exploratory approach) and depth (targeted mechanisms)

Table 1: Comparison of Experimental Approaches for HVA22E Studies

ApproachAdvantagesLimitationsOptimal Application
Gene knockout/CRISPRReveals physiological relevancePotential redundancy with other family membersPhenotypic characterization
Protein-protein interaction assaysIdentifies molecular partnersMay detect non-physiological interactionsPathway mapping
Subcellular localizationProvides spatial contextStatic visualization may miss dynamicsInitial characterization
Overexpression studiesReveals gain-of-function effectsMay cause non-physiological artifactsFunctional sufficiency testing

What is known about HVA22E's role in plant stress responses compared to other family members?

Based on research with related HVA22 proteins, HVA22E likely participates in stress response pathways, though with distinct features from other family members:

  • Comparative Functional Analysis:

    • AtHVA22a has been identified as having an agonistic effect on turnip mosaic virus (TuMV) propagation

    • The barley HVA22 inhibits gibberellin-induced formation of digestive vacuoles involved in programmed cell death

    • HVA22E's specific role would need to be experimentally determined through comparative studies

  • Methodological Approach for Differentiation:

    • Implement parallel phenotypic analysis of individual knockouts for each family member

    • Conduct complementation assays to test functional redundancy

    • Perform domain-swapping experiments to identify regions conferring specific functions

  • Stress Response Context:

    • Consider evaluating HVA22E's role across multiple stress conditions (drought, pathogen exposure, temperature extremes)

    • Quantify temporal dynamics of HVA22E expression relative to other family members

Research suggests that despite sequence similarity, individual HVA22 proteins may have evolved specialized functions in different stress response pathways, with some members potentially having antagonistic roles.

How does HVA22E interact with membrane remodeling machinery in Arabidopsis?

As a member of the HVA22 family related to Reep/DP1/Yop1 proteins, HVA22E likely participates in membrane remodeling processes. Investigation of these interactions requires specialized methodological approaches:

  • Membrane Curvature Assessment:

    • In vitro liposome tubulation assays using purified recombinant HVA22E

    • Quantitative electron microscopy to measure membrane curvature parameters

    • Live-cell imaging with membrane-specific dyes to track dynamics

  • Protein Complex Identification:

    • Split-ubiquitin membrane yeast two-hybrid assays as employed for AtHVA22a

    • Co-immunoprecipitation followed by mass spectrometry

    • Proximity labeling techniques (BioID, APEX) for in vivo interaction mapping

  • Functional Validation Approaches:

    • Reconstitution experiments with purified components

    • Structure-function analysis through mutagenesis of key domains

    • Time-resolved proteomics to capture dynamic interactions

Table 2: Predicted HVA22E Protein Interactions Based on Homology

Potential Interacting PartnersPredicted Interaction DomainBiological ContextDetection Method
Reticulon family proteinsTransmembrane hairpinsER morphology regulationMembrane-Y2H
SNARE machinery componentsC-terminal cytosolic domainVesicle traffickingCo-IP/MS
Viral movement proteinsTransmembrane domain 2Pathogen responseBiFC
Lipid transfer proteinsHydrophobic regionsMembrane compositionLiposome binding assays

What experimental approaches can resolve contradictory findings regarding HVA22 protein functions?

Research on HVA22 family proteins has sometimes yielded apparently contradictory results, such as promoting viral propagation in some contexts while inhibiting cellular processes in others. To resolve such contradictions, consider these methodological approaches:

  • Context-Dependent Analysis:

    • Systematically vary experimental conditions (tissue type, developmental stage, stress conditions)

    • Implement multivariate experimental designs to identify interaction effects

    • Apply Bayesian hierarchical modeling to integrate results across contexts

  • Technical Reconciliation:

    • Compare protein tagging strategies and their potential impact on function

    • Evaluate temporal dynamics at higher resolution

    • Standardize expression levels across experimental systems

  • Domain-Specific Functions:

    • The C-terminal tail of AtHVA22a has been identified as important for TuMV propagation

    • Transmembrane domain 2 is critical for protein localization and stability

    • Systematic domain deletion/swapping can map function to specific protein regions

  • Integration of Multiple Data Types:

    • Combine structural, interaction, and phenotypic data

    • Develop computational models that can reconcile seemingly contradictory observations

    • Consider allosteric effects and post-translational modifications as regulatory mechanisms

How can advanced imaging techniques enhance understanding of HVA22E dynamics?

Advanced imaging methodologies offer powerful approaches to characterize HVA22E dynamics and functions:

  • Super-Resolution Microscopy Applications:

    • STORM/PALM imaging to resolve nanoscale organization within membranes

    • Quantitative co-localization with organelle markers at subdiffraction resolution

    • Single-particle tracking for dynamic behavior analysis

  • Multi-Modal Imaging Approaches:

    • Correlative light and electron microscopy (CLEM) to connect fluorescence patterns with ultrastructure

    • Integrated spectroscopic imaging for protein-lipid interactions

    • Expansion microscopy for improved spatial resolution of membrane structures

  • Fluorescent Biosensor Development:

    • Design conformation-sensitive fluorescent reporters based on HVA22E

    • FRET-based interaction sensors for real-time monitoring

    • Optogenetic tools for acute manipulation of HVA22E function

  • Quantitative Image Analysis:

    • Machine learning segmentation of membrane compartments

    • Trajectory analysis for dynamic behaviors

    • Spatial statistics to characterize distribution patterns

Table 3: Comparison of Imaging Approaches for HVA22E Studies

Imaging TechniqueSpatial ResolutionTemporal ResolutionKey Applications for HVA22E Research
Confocal microscopy~200 nmSeconds to minutesBasic localization, co-localization with organelle markers
TIRF microscopy~100 nmMillisecondsMembrane-associated dynamics at cell surface
STORM/PALM10-20 nmMinutes (fixed)Nanoscale organization within membranes
Lattice light-sheet~300 nmSubsecond3D dynamics with reduced photodamage
Cryo-electron microscopy3-5 ÅStaticStructural studies of purified protein

How does HVA22E function in viral resistance pathways compared to AtHVA22a?

The recent discovery that AtHVA22a plays an agonistic role in turnip mosaic virus (TuMV) propagation raises important questions about HVA22E's potential function in viral resistance:

  • Comparative Functional Assessment:

    • Implement parallel virus infection assays in knockout/overexpression lines for each family member

    • Quantify viral replication rates using reporter-tagged viral constructs

    • Compare subcellular localization during infection

  • Virus-Specific Interactions:

    • Test interactions with viral proteins using split-ubiquitin membrane yeast two-hybrid assays similar to those used for AtHVA22a/6K2 interaction

    • Evaluate specificity across different plant virus families

    • Map interaction domains through deletion analysis

  • Pathway Integration Analysis:

    • Position HVA22E relative to known viral resistance pathways

    • Examine relationships with RNA silencing machinery

    • Investigate potential roles in plasmodesmata regulation

Table 4: Methodological Approaches to Study HVA22E in Viral Resistance

MethodReadoutAdvantagesConsiderations
VIGS-based knockdownVirus accumulationRapid assessmentPotential off-target effects
Transgenic overexpressionInfection phenotypesGain-of-function insightsExpression level variations
BiFC with viral proteinsInteraction localizationIn vivo validationPotential artifacts from overexpression
Transcriptomics of infected tissuesGlobal response patternsSystem-level insightsIndirect effects

What is the significance of the C-terminal domain in HVA22E function?

Research on AtHVA22a has identified the C-terminal tail as important for TuMV propagation , suggesting this domain may have critical functional roles in HVA22E as well:

  • Domain Structure-Function Analysis:

    • Generate systematic C-terminal truncations and point mutations

    • Assess impact on protein localization, stability, and function

    • Compare C-terminal sequences across family members and species

  • Interaction Mapping:

    • Use the C-terminal domain as bait in yeast two-hybrid or pull-down assays

    • Implement peptide arrays to map specific binding motifs

    • Perform cross-linking followed by mass spectrometry to identify transient interactions

  • Evolutionary Conservation Assessment:

    • Conduct phylogenetic analysis of C-terminal sequences

    • Identify conserved motifs and post-translational modification sites

    • Consider evolutionary rate analysis to detect signatures of selection

The C-terminal domain likely mediates key protein-protein interactions that determine the specific functional outputs of each HVA22 family member within different cellular contexts.

How can CRISPR-Cas9 approaches be optimized for functional studies of HVA22E?

CRISPR-Cas9 technology offers powerful approaches for functional characterization of HVA22E through precise genetic manipulation:

  • Guide RNA Design Optimization:

    • Implement computational algorithms to minimize off-target effects

    • Target functional domains identified through comparative analysis

    • Consider paired nickase approaches for enhanced specificity

  • Multiplex Editing Strategies:

    • Simultaneously target multiple HVA22 family members to address functional redundancy

    • Create allelic series through microhomology-mediated end joining

    • Implement base editing for specific amino acid substitutions

  • Functional Readout Systems:

    • Design phenotypic screens relevant to membrane trafficking

    • Implement reporter systems for stress response pathways

    • Develop high-throughput imaging assays for subcellular phenotypes

Table 5: CRISPR-Cas9 Strategies for HVA22E Functional Studies

ApproachApplicationKey ConsiderationsExpected Outcome
KnockoutLoss-of-function analysisPotential redundancy with other family membersPhenotypic consequences of complete absence
Knock-in tagsEndogenous localizationMaintain native expression levelsAuthentic spatiotemporal dynamics
Domain editingStructure-function analysisTarget conserved regionsSpecific functional perturbations
Promoter modificationExpression regulationCareful selection of regulatory elementsControlled expression contexts

Research has demonstrated the utility of CRISPR-Cas9 for mutagenesis of AtHVA22a, which slowed down TuMV propagation , suggesting similar approaches would be valuable for HVA22E characterization.

What are the optimal protein extraction and purification methods for recombinant HVA22E?

As a transmembrane protein, HVA22E presents specific challenges for extraction and purification that require specialized approaches:

  • Membrane Protein Solubilization:

    • Systematic screening of detergents (DDM, LMNG, digitonin) for optimal extraction

    • Consideration of amphipol or nanodisc reconstitution for structural studies

    • Evaluation of extraction efficiency using quantitative western blotting

  • Purification Strategy Optimization:

    • Two-step chromatography approach (affinity followed by size exclusion)

    • On-column detergent exchange during purification

    • Quality control through dynamic light scattering and thermal stability assays

  • Functional Validation:

    • Reconstitution into liposomes to assess membrane remodeling activity

    • Activity assays based on known HVA22 functions

    • Structural integrity verification through circular dichroism

Table 6: Detergent Screening Strategy for HVA22E Purification

Detergent ClassExamplesOptimal Concentration RangeApplications
MaltosidesDDM, UDM0.5-2× CMCGeneral screening, initial extraction
GlucosidesOG, NG1-3× CMCStructural studies, crystallization
NonionicDigitonin, LMNG0.05-0.5%Gentle extraction, complex preservation
ZwitterionicCHAPS, FC-160.5-1.5%Higher stringency extraction

What considerations are important for designing HVA22E constructs for heterologous expression?

The design of expression constructs significantly impacts recombinant HVA22E yield, localization, and functionality:

  • Expression System Selection:

    • E. coli: Suitable for domains but challenging for full-length protein

    • Yeast (P. pastoris): Better for full-length membrane proteins

    • Insect cells: Appropriate for complex folding requirements

    • Plant-based systems: Optimal for native functionality

  • Fusion Tag Considerations:

    • N-terminal vs. C-terminal tag placement based on domain functions

    • Cleavable vs. non-cleavable tags depending on downstream applications

    • Size impact (small His6 vs. larger MBP) on protein folding and solubility

  • Codon Optimization Strategy:

    • Organism-specific codon usage adjustment

    • RNA secondary structure minimization

    • GC content normalization for expression efficiency

  • Regulatory Element Selection:

    • Inducible vs. constitutive promoters based on potential toxicity

    • Terminator efficiency for proper transcript processing

    • Consideration of translation enhancement elements

Table 7: Promoter Systems for HVA22E Expression

Expression SystemRecommended PromotersInduction MethodExpression Characteristics
E. coliT7, trcIPTGHigh expression, inclusion body risk
P. pastorisAOX1, GAPMethanol/ConstitutiveControlled induction, glycosylation
Insect cellsPolyhedrin, p10Viral infectionHigh yield, complex processing
Plant systems35S, estrogen-inducibleβ-estradiolNative modifications, lower yield

What are the most promising research directions for understanding HVA22E function?

Based on current knowledge of HVA22 family proteins, several high-priority research directions emerge for HVA22E:

  • Mechanistic Understanding:

    • Structural characterization through cryo-EM or X-ray crystallography

    • Identification of protein and lipid interaction partners

    • Elucidation of regulatory mechanisms controlling activity

  • Physiological Context:

    • Developmental stage-specific functions during seed germination and stress responses

    • Tissue-specific expression patterns and phenotypic consequences

    • Integration with hormone signaling networks beyond ABA and GA

  • Evolutionary Perspective:

    • Comparative analysis across plant species to identify core conserved functions

    • Investigation of potential neofunctionalization among paralogs

    • Reconstruction of ancestral states to understand functional divergence

  • Translational Applications:

    • Potential for engineering stress resilience through HVA22E modulation

    • Development of biosensors based on HVA22E domains

    • Use as a model for understanding membrane protein evolution and function

By applying rigorous experimental design principles and building on foundational knowledge of related proteins , researchers can make significant advances in understanding this important but understudied plant protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.