Recombinant Arabidopsis thaliana HVA22-like protein f (HVA22F)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
HVA22F; At2g42820; F7D19.18; HVA22-like protein f; AtHVA22f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-158
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
HVA22F
Target Protein Sequence
MGFIIAIAKRFDALVGPGVMLLYPLYASFRAIESPTMLDDQQWLTYWIIYSLITIFELSV WRVLAWLPFWPYLKLLFCMWLVLPMFSGAAYIYSNFVRQYVKIGMNVGGGTNYTDEQRRV LQMMSLDARKSVQDYVDRFGWDSVEKAIKAAEKETRKH
Uniprot No.

Target Background

Database Links

KEGG: ath:AT2G42820

STRING: 3702.AT2G42820.1

UniGene: At.49581

Protein Families
DP1 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is HVA22F and which protein family does it belong to?

HVA22F (AtHVA22f) is one of several HVA22-like proteins found in Arabidopsis thaliana. It belongs to the HVA22 family of genes, which encode stress response proteins with a conserved TB2/DP1/HVA22 domain unique to eukaryotes . These proteins are plant-specific homologues of the Reep/DP1/Yop1 family proteins found in animals and yeast . The HVA22 family was originally identified in barley (Hordeum vulgare) as transcripts accumulating in aleurone tissue upon abscisic acid (ABA) treatment and in vegetative tissues exposed to drought or cold stress . In Arabidopsis thaliana, there are at least five homologs of HVA22, including HVA22F, which are differentially regulated by hormonal and developmental signals .

How is HVA22F expression regulated in plants?

The expression of HVA22 family genes, including HVA22F, is regulated by various environmental stresses and phytohormones. Promoter analysis of HVA22 genes has revealed several regulatory elements, including:

  • ABA response elements (ABRE)

  • Ethylene response elements (ERE)

  • Methyl jasmonate response elements (CGGTA-motif and TGACG-motif)

  • Gibberellin response elements (GARE-motif, P-box, and TATC-box)

  • Salicylic acid-responsive elements (SARE and TCA-element)

Additionally, stress-responsive elements have been identified in HVA22 promoters, including:

  • Low temperature response elements (LTR)

  • Defense and stress response elements (TC-rich repeats)

  • Anaerobic inducible elements (ARE)

  • Wound response elements (WUN and WRE3 motifs)

This complex regulatory network allows for fine-tuned expression of HVA22F in response to various environmental and developmental cues.

What are the recommended methods for recombinant expression of HVA22F?

For successful recombinant expression of HVA22F, researchers typically use the following approach:

  • Expression System Selection: E. coli is commonly used for expressing recombinant HVA22F . The full-length protein (1-158 amino acids) can be expressed with an N-terminal His-tag for purification purposes.

  • Vector Construction:

    • Clone the full-length HVA22F coding sequence into an appropriate expression vector

    • Add a 10xHis tag at the N-terminus for purification

    • Confirm the construct through sequencing

  • Expression Conditions:

    • Transform into a suitable E. coli strain

    • Optimize induction conditions (temperature, IPTG concentration, induction time)

    • For membrane proteins like HVA22F, lower induction temperatures (16-25°C) often yield better results

  • Storage Considerations:

    • Store at -20°C; for extended storage, conserve at -80°C

    • Avoid repeated freezing and thawing

    • Working aliquots can be stored at 4°C for up to one week

How can protein-protein interactions of HVA22F be studied?

Several complementary approaches can be used to investigate HVA22F protein interactions:

  • Split-Ubiquitin Membrane Yeast Two-Hybrid Assays: This method is particularly suitable for membrane proteins like HVA22F. It has been successfully used to identify interactions between TuMV6K2 and AtHVA22a, a related protein in the HVA22 family .

  • Bimolecular Fluorescence Complementation (BiFC): This approach allows visualization of protein interactions in planta. The interaction between TuMV6K2 and AtHVA22a was confirmed using this method, showing that the interaction occurs at the viral replication compartment during infection .

  • Co-Immunoprecipitation (Co-IP): Using tagged versions of HVA22F, researchers can pull down protein complexes and identify interacting partners through mass spectrometry.

  • Protein-Protein Interaction Network Analysis: Computational approaches have been used to predict interactions of HVA22 family proteins, suggesting connections to proteins involved in root development, such as RHD3 .

What approaches are effective for studying HVA22F function in planta?

To elucidate the function of HVA22F in plants, researchers can employ these strategies:

  • CRISPR-Cas9 Mutagenesis: Targeted knockout of HVA22F can be achieved using CRISPR-Cas9, allowing for precise genome editing. This approach has been successfully used with other genes in Arabidopsis thaliana . The pKIR vector system developed by Tsutsui and Higashiyama offers an efficient method for genome editing in Arabidopsis .

  • Overexpression Studies: Constitutive or inducible overexpression of HVA22F can provide insights into its function. For example, overexpression of GhHVA22E1D in Arabidopsis enhanced salt and drought tolerance .

  • Virus-Induced Gene Silencing (VIGS): This approach has been used successfully to silence HVA22 genes in cotton, demonstrating reduced salt and drought tolerance when GhHVA22E1D was silenced .

  • Subcellular Localization: Fluorescent protein fusions can determine the precise subcellular localization of HVA22F. Most HVA22 proteins are predicted to localize to the plasma membrane, though some may target other cellular compartments .

How does HVA22F contribute to stress response mechanisms?

HVA22F and related proteins appear to function in stress responses through several mechanisms:

  • Regulation of Vesicular Traffic: HVA22 proteins likely regulate vesicular traffic in stressed cells to either facilitate membrane turnover or decrease unnecessary secretion . This function is supported by studies of the yeast homolog Yop1p, which interacts with the GTPase-interacting protein Yip1p.

  • Membrane Dynamics: The conserved TB2/DP1/HVA22 domain suggests a role in membrane remodeling or maintenance during stress conditions.

  • Antioxidant Capacity: Experimental evidence indicates that HVA22 genes like GhHVA22E1D may enhance plant stress tolerance by altering the antioxidant capacity of plants . This could involve modulation of ROS signaling pathways or direct effects on antioxidant systems.

  • Stress Signaling Integration: The presence of multiple stress-responsive elements in HVA22 promoters suggests these genes integrate various stress signals to coordinate appropriate cellular responses .

What is the relationship between HVA22F and viral propagation in plants?

Research on AtHVA22a, another member of the HVA22 family, provides insights into potential roles of HVA22F in viral interactions:

  • Viral Replication Compartment Association: AtHVA22a interacts with the 6K2 protein of turnip mosaic virus (TuMV) at the viral replication compartment during infection .

  • Agonistic Effect on Viral Propagation: Overexpression of AtHVA22a increases TuMV propagation, while CRISPR-Cas9 mutagenesis of AtHVA22a slows down viral spread .

  • C-terminal Domain Importance: The C-terminal tail of AtHVA22a is particularly important for its role in viral propagation . Given the sequence variability in C-terminal regions among HVA22 family members , HVA22F may have distinct effects on viral interactions compared to AtHVA22a.

  • Vesicular Transport Connection: Given the role of HVA22 proteins in regulating vesicular traffic , HVA22F might influence viral movement through effects on cellular transport pathways that viruses hijack for propagation.

How does HVA22F compare functionally to homologs in other species?

The HVA22 family is evolutionarily conserved across plant species with some key differences:

  • Structural Divergence: While the core TB2/DP1/HVA22 domain is conserved, there are significant differences in protein length and terminal regions. For instance, the yeast and human homologs contain a 40-48 amino acid N-terminal region not present in barley HVA22 and some Arabidopsis homologs .

  • Functional Conservation in Stress Response: Despite structural differences, HVA22 homologs across species share roles in stress responses. For example, cotton GhHVA22E1D enhances salt and drought tolerance when overexpressed in Arabidopsis , suggesting functional conservation.

  • Subcellular Localization Patterns: The subcellular localization of HVA22 proteins varies by lineage. Proteins in lineages A, C, E, F, and H localize to the plasma membrane, while G lineage proteins target the extracellular space. Lineages I, J, and K show multiple localization patterns .

  • Expansion Patterns: The HVA22 gene family has undergone different patterns of expansion in various species. In cotton, for example, 34, 32, 16, and 17 HVA22 genes were identified in G. barbadense, G. hirsutum, G. arboreum, and G. raimondii, respectively, with amplification primarily due to segmental duplication or whole genome replication .

How can HVA22F research contribute to crop improvement strategies?

Understanding HVA22F and related proteins offers several avenues for potential crop improvement:

  • Enhanced Stress Tolerance: Overexpression of HVA22 genes has demonstrated improved tolerance to abiotic stresses such as drought and salinity . Engineering HVA22F expression could potentially enhance crop resilience to environmental challenges.

  • Viral Resistance Engineering: Given the interaction between HVA22 proteins and viral components , modifying HVA22F could potentially alter susceptibility to certain plant viruses, contributing to disease resistance strategies.

  • Root Development Optimization: The association of HVA22 family proteins with root development suggests potential applications in improving root architecture for better nutrient acquisition and drought tolerance.

  • Stress Signaling Modulation: The integration of multiple stress responsive elements in HVA22 promoters provides potential targets for engineering crops with optimized stress responses.

What are the most promising techniques for investigating HVA22F structural properties?

Several advanced techniques can provide insights into HVA22F structure:

  • Crystallography: Following the approach used for threonine synthase in Arabidopsis , HVA22F could be crystallized using sitting drop vapor diffusion methods. X-ray diffraction could then resolve the protein structure at high resolution.

  • Cryo-Electron Microscopy: This technique is particularly valuable for membrane proteins and could elucidate the interaction between HVA22F and membrane structures.

  • Molecular Dynamics Simulations: Computational approaches can model the behavior of HVA22F in membrane environments and predict structural changes under different conditions.

  • NMR Spectroscopy: For specific domains or shorter fragments of HVA22F, solution NMR could provide structural information and insights into dynamic properties.

  • Site-Directed Mutagenesis Combined with Functional Assays: Systematic mutation of key residues can help map structure-function relationships, particularly for the C-terminal region known to be important in related proteins .

What genome-wide approaches could enhance our understanding of HVA22F function?

Several genome-scale methods offer promise for deepening our understanding of HVA22F:

  • Genome-Wide Association Studies (GWAS): Similar to approaches used to study leaf microbiome composition in Arabidopsis , GWAS could identify genetic loci that interact with HVA22F or influence its function.

  • Transcriptomic Analysis: RNA-seq experiments comparing wild-type and HVA22F mutant plants under various stress conditions could reveal downstream pathways affected by HVA22F function.

  • Proteomics Approaches: Mass spectrometry-based proteomics could identify proteins that interact with HVA22F or undergo changes in abundance or modification in response to HVA22F perturbation.

  • Metabolomic Profiling: Analysis of metabolite changes in HVA22F mutants could provide insights into biochemical pathways influenced by this protein.

  • Natural Variation Studies: Examining HVA22F sequence and expression variation across Arabidopsis ecotypes, similar to the approach used for studying defensive compounds , could reveal adaptive significance of HVA22F polymorphisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.