Recombinant Arabidopsis thaliana Isoprenylcysteine alpha-carbonyl methylesterase ICME (ICME)

Shipped with Ice Packs
In Stock
Cat. No.
BT2506529
Source
in vitro E.coli expression system
Synonyms
ICME; PCME; At5g15860; F14F8.240; Isoprenylcysteine alpha-carbonyl methylesterase ICME; Isoprenylcysteine methylesterase; Prenylcysteine methylesterase; AtPCME
Quick Inquiry

Description

Introduction to Recombinant Arabidopsis thaliana Isoprenylcysteine alpha-carbonyl methylesterase ICME

Recombinant Arabidopsis thaliana Isoprenylcysteine alpha-carbonyl methylesterase ICME is an enzyme involved in the demethylation of prenylated proteins in eukaryotic cells. This enzyme plays a crucial role in plant signaling pathways, particularly in abscisic acid (ABA) signaling, which is essential for plant responses to environmental stresses such as drought and osmotic stress.

Function and Role of ICME in ABA Signaling

ICME functions as a positive regulator of ABA signaling. It demethylates prenylated proteins, which can modulate their activity and localization within the cell. In Arabidopsis, overexpression of ICME leads to an ABA-hypersensitive phenotype, characterized by enhanced stomatal closure and inhibition of seed germination in response to ABA . This hypersensitivity suggests that ICME plays a significant role in amplifying ABA signals, which are critical for plant survival under stress conditions.

Subcellular Localization and Expression Patterns

ICME and its homologs in Arabidopsis are primarily localized to the endoplasmic reticulum (ER) and Golgi apparatus. This localization is consistent with their role in processing prenylated proteins, which undergo further modifications in these organelles . The expression of ICME is induced by ABA, creating a positive feedback loop that enhances ABA responsiveness in plant cells .

4.1. Phenotypic Effects of ICME Overexpression

PhenotypeEffect of ICME Overexpression
Stomatal ClosureEnhanced closure in response to ABA
Seed GerminationIncreased inhibition by ABA
Root GrowthNo significant change in response to ABA

4.2. Expression and Localization

ProteinSubcellular Localization
ICMEEndoplasmic Reticulum, Golgi Apparatus
ICME-LIKE1Similar to ICME
ICME-LIKE2Similar to ICME

4.3. Biochemical Characteristics

ICME belongs to the carboxylesterase family and contains a conserved catalytic triad (serine, aspartate, and histidine) essential for its enzymatic activity . The enzyme specifically demethylates biologically relevant isoprenylcysteine methyl esters, contributing to the regulation of prenylated proteins .

Recombinant Production of ICME

Recombinant ICME can be produced in various expression systems, including yeast, E. coli, and mammalian cells . This versatility allows for the production of ICME with different tags or modifications, facilitating its use in biochemical assays and structural studies.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms are stable for 6 months at -20°C/-80°C, while lyophilized forms are stable for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag is required, please inform us, and we will prioritize its inclusion.
Synonyms
ICME; PCME; At5g15860; F14F8.240; Isoprenylcysteine alpha-carbonyl methylesterase ICME; Isoprenylcysteine methylesterase; Prenylcysteine methylesterase; AtPCME
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-427
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ICME
Target Protein Sequence
MHSPLQTQQPEQRCWPMTSTVSEIEEVLPDEDSDRTTLLNGEPLRRRVSGKSPVDEGPRR IFRQQSFGRDIGHAAAETYLITGLSFKLLRYLGVGYRWMTKLLALTCYAMLLMPGFLQVA YSYFFSKQVRRSIVYGDQPRNRLDLYLPSNNDGLKPVVVFVTGGAWIIGYKAWGSLLGMQ LAERDIIVACLDYRNFPQGTISDMVTDASQGISFVCNNISAFGGDPNRIYLMGQSAGAHI AACALLEQATKELKGESISWTVSQIKAYFGLSGGYNLYKLVDHFHNRGLYRSIFLSIMEG EESFEKFSPEVRLKDPVVGKAASLLPPIILFHGSSDYSIPCDESKTFTDALQAVGAKAEL VLYSGKTHTDLFLQDPLRGGKDELFDDIVSVIHAEDNDGLTKDSLAPPRKRLVPELLLKL AREISPF
Uniprot No.
Q94AS5

Target Background

Function
This recombinant Arabidopsis thaliana Isoprenylcysteine alpha-carbonyl methylesterase (ICME) catalyzes the demethylation of isoprenylcysteine methylesters. It exhibits in vitro specificity for N-acetyl-S-farnesyl-L-cysteine methyl ester (AFCme) with low activity toward N-acetyl-S-geranyl-L-cysteine methyl ester (AGCme). Functionally, ICME acts as a positive regulator of ABA signaling and may be involved in the demethylation and inactivation of isoprenylated negative regulators of abscisic acid (ABA) signaling. Carboxyl methylation represents a reversible and potentially regulated post-translational modification step in prenylated proteins.
Gene References Into Functions
  1. The At5g15860 gene confers prenylcysteine alpha-carboxyl methylesterase (PCME) activity in Arabidopsis thaliana membranes. PMID: 16870359
Database Links

KEGG: ath:AT5G15860

STRING: 3702.AT5G15860.1

UniGene: At.10166

Protein Families
AB hydrolase superfamily, Isoprenylcysteine methylesterase family
Subcellular Location
Endoplasmic reticulum membrane. Golgi apparatus membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in roots, rosette and cauline leaves, stems, flowers and siliques.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.