Recombinant Arabidopsis thaliana LAG1 longevity assurance homolog 1 (LAG1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
LOH1; LAG1; At3g25540; MWL2.19; Ceramide synthase LOH1; CS1; CSII; Protein LONGEVITY ASSURANCE GENE ONE HOMOLOG 1; LAG One Homolog 1; LAG1 homolog 1; LAG1 longevity assurance homolog 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
LAG1
Target Protein Sequence
MGLFESVKSIDWEQESFPTYQDLGFLPLFAVFFPTIRFLLDRFVFEKLASLVIYGRMSTN KSDNIKDRKKNSPKVRKFKESAWKCIYYLSAELLALSVTYNEPWFSNTLYFWIGPGDQIW PDQPMKMKLKFLYMFAAGFYTYSIFALVFWETRRSDFGVSMGHHITTLVLIVLSYICRLT RAGSVILALHDASDVFLEIGKMSKYCGAESLASISFVLFALSWVVLRLIYYPFWILWSTS YQIIMTVDKEKHPNGPILYYMFNTLLYFLLVLHIFWWVLIYRMLVKQVQDRGKLSEDVRS DSESDDEHED
Uniprot No.

Target Background

Function
LAG1 longevity assurance homolog 1 (LAG1) is essential for plant growth and promotes cell division in root meristems. It catalyzes the biosynthesis of ceramide sphingolipids with C(16) to C(28) fatty acids, which are structural membrane lipids involved in membrane trafficking (e.g., early endosomes) and cell polarity (e.g., polar auxin transport-related proteins). LAG1 is primarily active with t18:0 and saturated very long saturated fatty acids (C24:0 and C26:0), such as long-chain base (LCB) phytosphingosine (t18:0), lignoceroyl- and hexacosanoyl-CoAs. LAG1 mediates resistance to sphinganine-analog mycotoxins (SAMs, e.g., fumonisin B(1)) by restoring sphingolipid biosynthesis. It can salvage the transport of GPI-anchored proteins from the endoplasmic reticulum to the Golgi apparatus in ceramides-depleted cells after SAM exposure. LAG1 may prevent precocious cell death by delaying PR1 accumulation during aging. Additionally, it contributes to hypoxic conditions tolerance (e.g., submergences), particularly in the dark, by promoting the formation of very-long-chain (VLC) ceramide species (22:1, 24:1, and 26:1) and VLC unsaturated ceramides. These VLC ceramides modulate CTR1-mediated ethylene signaling, leading to the endoplasmic reticulum (ER)-to-nucleus translocation of EIN2 and EIN3.
Gene References Into Functions
  1. Research suggests that AtORM1 and AtORM2 mediation of serine palmitoyltransferase (SPT) activity differentially regulates functionally distinct ceramide synthase activities as part of a broader sphingolipid homeostatic regulatory network. PMID: 27506241
  2. The role of At3g25540 in sphingolipid metabolism, mycotoxin resistance, and cell death. PMID: 26276842
  3. Spontaneous cell death in the loh1 line is triggered either by the accumulation of free trihydroxy sphingoid bases or ceramide species with C(16) fatty acid. [LOH1] PMID: 21883234
Database Links

KEGG: ath:AT3G25540

STRING: 3702.AT3G25540.1

UniGene: At.6098

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed ubiquitously at high levels. Not observed in pollen.

Q&A

What is the LAG1 longevity assurance gene and its relationship to ceramide synthases in Arabidopsis thaliana?

The LAG1 (Longevity Assurance Gene 1) family in Arabidopsis thaliana includes ceramide synthase enzymes that catalyze a critical step in sphingolipid biosynthesis. In Arabidopsis, there are three ceramide synthase isoforms: LOH1, LOH2, and LOH3 (LAG One Homologs) . These enzymes are functionally related to the original LAG1 identified in yeast, where deletion leads to increased replicative lifespan . The LAG1 motif is evolutionarily conserved across eukaryotes, suggesting these proteins serve fundamental cellular functions . In Arabidopsis and other plants, these enzymes produce ceramides with specific acyl chain lengths and configurations that influence membrane properties and cellular signaling pathways.

How do the different ceramide synthase isoforms in Arabidopsis compare functionally?

Each Arabidopsis ceramide synthase isoform exhibits distinct substrate preferences and physiological functions:

IsoformPreferred Acyl-CoA Chain LengthPreferred Sphingoid BaseMajor ProductsKnockout Phenotype
LOH1Very-long-chain (C20-C28)Trihydroxy sphingoid basesCeramides with C20-C28 fatty acidsSpontaneous cell death
LOH2C16 fatty acidsTrihydroxy sphingoid basesCeramides with C16 fatty acidLess severe than LOH1 knockouts
LOH3Long-chain (C16-C18)Dihydroxy sphingoid basesCeramides with C16-C18 fatty acidsSimilar to wild-type under normal conditions

These functional differences are critical for understanding sphingolipid metabolism in plants, as each isoform contributes uniquely to the ceramide pool. Biochemical analysis shows that disruption of LOH1 leads to significant alterations in the ceramide profile, with reduced very-long-chain ceramides and accumulated C16 ceramides and free trihydroxy sphingoid bases .

What methods are effective for expressing and characterizing recombinant LAG1 homologs?

For effective expression and characterization of recombinant LAG1 homologs in Arabidopsis, researchers should consider:

  • Heterologous expression systems: Yeast complementation assays are particularly valuable, as demonstrated with the functional expression of homologous LAG1 proteins from diverse species in yeast LAG1/DGT1 double mutants . This approach allows assessment of functional conservation across species.

  • In vitro enzyme assays: Purified recombinant protein can be used to determine substrate specificity by measuring ceramide synthase activity with different acyl-CoA substrates and sphingoid bases.

  • Domain analysis: Targeted mutagenesis of specific domains, particularly the conserved LAG1 motif, can provide insights into structure-function relationships. For example, truncation experiments with the N-terminal region of threonine synthase (another SAM-regulated enzyme) demonstrated this region's importance for regulation .

  • Subcellular localization: Fluorescent protein tagging combined with confocal microscopy allows determination of the protein's cellular compartmentalization, typically in the endoplasmic reticulum for LAG1 homologs.

How should researchers design experiments to study LAG1 knockout mutants?

When designing experiments with LAG1/LOH knockout mutants, researchers should:

  • Maintain appropriate growth conditions: Phenotypes may be condition-dependent. For example, LOH1 knockout plants exhibit spontaneous cell death after extended culture under short-day conditions .

  • Monitor comprehensive sphingolipid profiles: Quantify changes in:

    • Free sphingoid bases (particularly trihydroxy bases)

    • Ceramide species with different fatty acid chain lengths

    • Complex sphingolipids (glucosylceramides, glycosylinositolphosphoceramides)

  • Assess gene expression changes: Measure expression of genes involved in programmed cell death and defense responses. For example, PR-1 (pathogenesis-related gene) expression increases in LOH1 knockout plants showing spontaneous cell death .

  • Evaluate multiple developmental stages: Phenotypes may manifest differently at various growth stages due to changing sphingolipid requirements.

  • Implement complementation studies: Express the wild-type gene to confirm phenotype rescue and utilize site-directed mutants to identify critical residues.

How does sphingolipid metabolism interface with cellular stress responses in plants?

Sphingolipid metabolism is intricately connected to stress responses in plants through several mechanisms:

  • Ceramide accumulation: Stress conditions often trigger ceramide accumulation, which can induce programmed cell death. In LOH1 knockout plants, altered ceramide profiles (reduced very-long-chain ceramides, increased C16 ceramides) correlate with spontaneous cell death .

  • Sphingoid base signaling: Free sphingoid bases act as second messengers in stress signaling cascades. Elevated levels of free trihydroxy sphingoid bases in LOH1 mutants may trigger cell death pathways .

  • Membrane integrity: Sphingolipids contribute to membrane microdomains (lipid rafts) that host many stress signaling components. Disruption of normal sphingolipid composition affects membrane organization and signal transduction.

  • Cross-talk with other pathways: Sphingolipid metabolism interconnects with other stress response pathways. For instance, the LAG1 homolog in tomato (Asc-1) mediates resistance to the mycotoxin AAL-toxin through a mechanism potentially involving GPI-anchored protein transport .

What methodological approaches should be used to analyze ceramide profiles in LAG1 mutants?

For comprehensive ceramide profiling in LAG1/LOH mutants, researchers should utilize:

  • Liquid chromatography-mass spectrometry (LC-MS/MS): This provides the most detailed characterization of diverse ceramide species with different chain lengths and hydroxylation patterns.

  • Sphingolipidomics workflow:

    • Extract total lipids using chloroform/methanol extraction

    • Perform mild alkaline hydrolysis to remove glycerolipids

    • Separate sphingolipid classes by solid-phase extraction

    • Analyze using HPLC coupled to electrospray ionization mass spectrometry

    • Quantify using internal standards for each sphingolipid class

  • Structural analysis considerations:

    • Identify fatty acid chain length (C16-C28)

    • Determine sphingoid base hydroxylation status (di- vs. tri-hydroxy)

    • Measure glycosylation patterns of complex sphingolipids

  • Tissue-specific analysis: Compare sphingolipid profiles across different tissues and developmental stages to identify context-specific alterations.

What mechanisms link LAG1 disruption to spontaneous cell death in Arabidopsis?

The connection between LAG1/LOH1 disruption and spontaneous cell death likely involves several interrelated mechanisms:

  • Altered sphingolipid balance: In LOH1 knockout plants, two critical changes occur:

    • Significant reduction in very-long-chain (C20-C28) ceramides and glucosylceramides

    • Accumulation of C16 ceramides and free trihydroxy sphingoid bases

  • Bioactive lipid signaling: Either the accumulation of C16 ceramides or free trihydroxy sphingoid bases likely triggers cell death pathways through:

    • Activation of specific protein kinases and phosphatases

    • Induction of ROS (reactive oxygen species) production

    • Modulation of calcium signaling

  • Immune response activation: LOH1 knockout plants show enhanced expression of the pathogenesis-related gene PR-1, indicating activation of defense responses similar to those triggered during pathogen infection .

  • Disrupted membrane organization: Changes in ceramide composition affect membrane microdomains, potentially disturbing signaling platforms and protein trafficking.

How do environmental conditions influence LAG1-mediated phenotypes?

Environmental conditions significantly modulate LAG1/LOH-associated phenotypes through:

  • Light conditions: LOH1 knockout plants develop spontaneous cell death specifically after extended culture under short-day conditions , suggesting interaction between light signaling and sphingolipid metabolism.

  • Stress exposure: Various abiotic stresses (temperature, drought, salt) likely exacerbate phenotypes in LAG1/LOH mutants by:

    • Further perturbing sphingolipid homeostasis

    • Increasing cellular reactive oxygen species

    • Activating stress-response pathways that interact with sphingolipid signaling

  • Developmental timing: The impact of LAG1/LOH disruption varies across developmental stages, with mature tissues often showing more pronounced effects.

  • Nutrient availability: Metabolic status influences sphingolipid metabolism and may modify phenotypic outcomes of LAG1/LOH mutations.

How can researchers distinguish between ceramide-dependent and ceramide-independent functions of LAG1 homologs?

Distinguishing ceramide-dependent from potentially ceramide-independent functions requires sophisticated experimental approaches:

  • Structure-function analysis: Generate point mutations that specifically affect ceramide synthase activity without disrupting protein folding or interactions. Compare these with mutations that preserve enzymatic activity but alter other functions.

  • Metabolite supplementation: Provide exogenous ceramides or sphingolipid precursors to determine if they rescue specific phenotypes in LAG1/LOH mutants.

  • Protein-protein interaction studies: Identify LAG1/LOH-interacting proteins using techniques such as:

    • Co-immunoprecipitation followed by mass spectrometry

    • Yeast two-hybrid screening

    • Bimolecular fluorescence complementation

  • Proteomics approach: Compare the abundance and post-translational modifications of proteins in wild-type versus LAG1/LOH mutants, focusing on potential ceramide-binding proteins and regulatory factors.

  • Parallel pathway analysis: Examine whether LAG1 overexpression affects pathways distinct from those altered by ceramide accumulation. Recent studies indicate LAG1 overexpression severely impacts phospholipid biosynthesis and membrane morphology independently of its role in ceramide synthesis .

What roles do LAG1 homologs play in heavy metal stress responses in plants?

Recent research has implicated LAG1 homologs in heavy metal stress responses:

  • Lead (Pb) homeostasis: Genome-wide association studies have identified TLC (TRAM-LAG1-CLN8) as a candidate gene involved in lead homeostasis in Arabidopsis .

  • Differential strategies: Plants appear to employ two distinct strategies for lead tolerance:

    • Low translocation with root accumulation, involving higher expression of EXT18 and HMA3, associated with thicker root cell walls and vacuolar sequestration

    • High translocation with effective compartmentalization, involving upregulation of TLC and ABC transporters

  • Experimental approach for investigation:

    • Assess heavy metal content in different tissues of LAG1/LOH mutants

    • Compare expression patterns of LAG1 homologs under heavy metal stress

    • Analyze changes in sphingolipid profiles during metal exposure

    • Investigate potential protein interactions between LAG1 homologs and metal transporters

What emerging technologies are advancing LAG1/LOH functional studies?

Several cutting-edge technologies are enhancing LAG1/LOH functional research:

  • CRISPR-Cas9 genome editing: Allows precise manipulation of LAG1/LOH genes, including:

    • Creation of knockout mutations

    • Introduction of specific amino acid changes

    • Promoter modifications for altered expression

    • Tagged versions for protein localization and interaction studies

  • Single-cell approaches: Provide insights into cell-specific responses to LAG1/LOH manipulation:

    • Single-cell RNA sequencing to identify cell-type-specific transcriptional changes

    • Single-cell metabolomics to detect sphingolipid variations at cellular resolution

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize membrane microdomains

    • Correlative light and electron microscopy to connect protein localization with ultrastructural changes

    • Fluorescent ceramide analogs to track sphingolipid trafficking

  • Systems biology integration:

    • Multi-omics approaches combining transcriptomics, proteomics, and metabolomics

    • Network analysis to position LAG1/LOH functions within cellular signaling webs

    • Predictive modeling of sphingolipid metabolism dynamics

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.