Recombinant Arabidopsis thaliana LAG1 longevity assurance homolog 2 (LAG2)

Shipped with Ice Packs
In Stock

Description

Introduction

The recombinant Arabidopsis thaliana LAG1 longevity assurance homolog 2 (LAG2), also known as LOH2 or ceramide synthase CS2, is a key enzyme involved in sphingolipid biosynthesis and defense responses in plants. As a homolog of the yeast longevity assurance gene LAG1, LAG2 plays critical roles in cell division regulation, stress tolerance, and mycotoxin resistance. Its recombinant production in E. coli facilitates functional studies and applications in plant biology and biotechnology.

Gene and Protein Information

ParameterDetails
Gene NameLAG2 (At3g19260)
UniProt IDQ9LJK3
Protein LengthFull-length: 296 amino acids (1–296 aa)
Source OrganismArabidopsis thaliana (produced recombinantly in E. coli)
TagN-terminal His-tag (for affinity purification)
Purity>90% (SDS-PAGE)
StorageLyophilized powder stored at -20°C/-80°C; glycerol recommended for stability

Recombinant Production

Recombinant LAG2 is expressed as a full-length protein with a His-tag for purification. Partial versions (e.g., CSB-EP873282DOA1) are also available but lack complete functional domains. Key production parameters include:

  • Expression Host: E. coli

  • Reconstitution: Deionized sterile water (0.1–1.0 mg/mL) with 5–50% glycerol for long-term storage .

  • Shelf Life: 12 months (lyophilized) or 6 months (liquid) at -20°C/-80°C .

Defense and Stress Responses

FunctionMechanismReferences
Salicylic Acid (SA) ProductionPromotes systemic acquired resistance (SAR) and hypersensitive response (HR)
Mycotoxin ResistanceSalvages sphingolipid biosynthesis after sphinganine-analog mycotoxin (SAM) exposure
Hypoxia ToleranceModulates very-long-chain (VLC) ceramide biosynthesis (C22:1, C24:1, C26:1)

LAG2 catalyzes the biosynthesis of ceramides with C16 fatty acids, which are critical for membrane integrity and defense signaling. Overexpression of LOH2 (LAG2) leads to dwarfism, constitutive SA accumulation, and resistance to fumonisin B1 (FB1) .

Cellular and Developmental Processes

  • Cell Division Regulation: Inhibits root meristem cell division, linking sphingolipid metabolism to growth control.

  • Membrane Trafficking: Facilitates GPI-anchored protein transport from the ER to the Golgi, compensating for ceramide depletion .

  • Ethylene Signaling: VLC ceramides modulate CTR1-mediated ethylene responses, influencing EIN2/EIN3 translocation.

Overexpression Studies

ParameterLOH2 OverexpressionControl
Plant PhenotypeSevere dwarfism, reduced biomassWild-type
Sphingolipid ProfileElevated C16 ceramides, dihydroxy LCBs (sphinganine)Unchanged
SA LevelsConstitutively highBasal levels
FB1 ResistanceReduced free LCBs/LCB-phosphates post-toxin exposureSusceptible

These studies highlight LAG2’s dual role in growth regulation and stress adaptation .

Mycotoxin Resistance Mechanisms

LAG2 restores sphingolipid biosynthesis disrupted by SAMs (e.g., fumonisin B1), preventing apoptosis. This involves:

  1. Ceramide Salvage: Synthesis of C16 ceramides to restore membrane function .

  2. LCB Homeostasis: Mitigation of toxic LCB-phosphate accumulation .

Enzymatic Activity

SubstrateSpecificityProduct
Fatty AcidsC16:0 (palmitoyl-CoA)Ceramide with C16 fatty acids
LCB DonorsDihydroxy LCBs (e.g., sphinganine)Ceramide sphingolipids

LAG2 exhibits strict specificity for C16 fatty acids but accepts diverse dihydroxy LCBs.

Post-Translational Modifications

  • Glycerol Additive: Stabilizes recombinant protein during storage (5–50% final concentration) .

  • Freezing/Thawing: Repeated cycles degrade activity; aliquoting is essential .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
LOH2; LAG1; LAG2; At3g19260; MVI11.18; Ceramide synthase LOH2; CS2; CSI; Protein LONGEVITY ASSURANCE GENE ONE HOMOLOG 2; LAG One Homolog 2; LAG1 homolog 2; LAG1 longevity assurance homolog 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-296
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
LAG2
Target Protein Sequence
MESVSSRGGDPVVKPSMEVWHFQIAVYFAFGFFFLRLVLDRYVFQRIALWLLSTGSAPIK LNDAATRAKIVKCKESLWKLLYYAACDFFVLQVIYHEPWARDIKLYFHGWPNQELKLSIK LYYMCQCGFYVYGVAALLAWETRRKDFAVMMSHHVITIILLSYSYLTSFFRIGAIILALH DASDVFMETAKIFKYSEKEFGASVCFALFAVSWLLLRLIYFPFWIIRATSIELLDYLDMT SAEGTLMYYSFNTMLLMLLVFHIYWWYLICAMIVRLLKNRGKVGEDIRSDSEDDDD
Uniprot No.

Target Background

Function
LAG2 (Longevity Assurance Homolog 2) is a protein in Arabidopsis thaliana that plays a crucial role in various cellular processes, including:
  • Cell division inhibition: LAG2 inhibits cell division in root meristems, contributing to plant growth regulation.
  • Salicylic acid (SA) production and hypersensitive response (HR): LAG2 promotes the production of SA, a key signaling molecule involved in plant defense responses, and contributes to the hypersensitive response, a localized cell death mechanism to limit pathogen spread.
  • Ceramide biosynthesis: LAG2 catalyzes the biosynthesis of ceramide sphingolipids with C(16) fatty acids. Ceramides are essential structural membrane lipids involved in various processes, including:
    • Membrane trafficking: Ceramides are particularly important for early endosome function.
    • Cell polarity: They play a role in processes like polar auxin transport, regulating plant development.
  • Mycotoxin resistance: LAG2 specifically accepts C16:0 fatty acids but can utilize a range of d18 sphingoid bases, including sphinganine (d18:0). This versatility allows LAG2 to restore sphingolipid biosynthesis, conferring resistance to sphinganine-analog mycotoxins (SAMs), such as fumonisin B(1), which disrupt sphingolipid metabolism.
  • GPI-anchored protein trafficking: LAG2 can help salvage the transport of GPI-anchored proteins from the endoplasmic reticulum to the Golgi apparatus in cells depleted of ceramides due to SAM exposure, contributing to cellular integrity.
  • Hypoxic stress tolerance: LAG2 promotes tolerance to hypoxic conditions, particularly in the dark, by influencing the formation of very-long-chain (VLC) ceramide species (22:1, 24:1 and 26:1) and VLC unsaturated ceramides. These ceramides modulate CTR1-mediated ethylene signaling, leading to the translocation of EIN2 and EIN3 proteins from the endoplasmic reticulum to the nucleus. This pathway contributes to plant adaptation to oxygen-deficient environments.
Gene References Into Functions
  1. The role of At3g19260 in sphingolipid metabolism, mycotoxin resistance and cell death. PMID: 26276842
Database Links

KEGG: ath:AT3G19260

STRING: 3702.AT3G19260.1

UniGene: At.14736

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed ubiquitously with highest levels in pollen.

Q&A

What is the LAG1 longevity assurance gene family in Arabidopsis thaliana?

The conservation of the LAG1 motif across diverse eukaryotes, including plants, fungi, insects, and mammals, suggests these proteins play fundamental roles in basic cellular functions . LAG gene family members are involved in sphingolipid biosynthesis pathways, specifically in the synthesis of ceramides, which are essential components of cell membranes and important signaling molecules.

How does LAG2 differ structurally and functionally from other LAG homologs in plants?

While the search results don't provide specific structural differences between LAG2 and other LAG homologs in Arabidopsis thaliana, we can infer from studies of related proteins that functional specialization likely exists. Based on research with yeast LAG homologs, we know that despite structural similarities, different LAG proteins can have distinct substrate specificities and biological functions .

In Arabidopsis, LAG1 homologs maintain the characteristic features of the LAG gene family, including transmembrane domains and the conserved LAG1 motif . Many also contain a C-terminal acidic domain present in most known LAG1 homologs . The functional distinctions between LAG2 and other homologs likely involve:

  • Tissue-specific expression patterns

  • Substrate preferences for particular fatty acid chain lengths or modifications

  • Involvement in specific stress responses or developmental processes

  • Potential roles in specialized sphingolipid biosynthesis pathways unique to plant systems

Unlike some other plant proteins that may serve redundant functions, the conservation of multiple LAG homologs suggests they likely have evolved specialized roles, similar to how yeast LAG1 functions in longevity assurance while the related LAC1 does not, despite catalyzing similar reactions .

What are the recommended protocols for expressing recombinant Arabidopsis thaliana LAG2 in bacterial systems?

For successful expression of recombinant Arabidopsis thaliana LAG2, researchers should consider the following methodological approach:

  • Vector Selection and Construct Design:

    • Use pET-series vectors (particularly pET28a or pET32a) for high-level expression

    • Include an N-terminal 6xHis-tag for purification purposes

    • Consider codon optimization for E. coli expression if initial expression attempts yield poor results

    • Remove transmembrane domains if expressing the full protein proves challenging

  • Expression System:

    • E. coli BL21(DE3) or Rosetta(DE3) strains are recommended for expression of plant proteins

    • For membrane-associated proteins like LAG2, specialized strains such as C41(DE3) or C43(DE3) may improve yields

  • Culture Conditions:

    • Initial culture growth at 37°C until OD600 reaches 0.6-0.8

    • Reduce temperature to 16-18°C before induction

    • Induce with 0.1-0.5 mM IPTG

    • Continue expression for 16-20 hours at the reduced temperature

  • Protein Extraction and Purification:

    • For transmembrane proteins like LAG2, use appropriate detergents (e.g., n-dodecyl β-D-maltoside)

    • Utilize immobilized metal affinity chromatography for initial purification

    • Consider size exclusion chromatography as a secondary purification step

  • Validation:

    • Confirm protein identity via Western blot using anti-His antibodies

    • Verify protein function through ceramide synthase activity assays

Since LAG2 is involved in sphingolipid metabolism, researchers should be particularly attentive to the proper folding of the protein, which may require specialized conditions or expression systems beyond standard protocols.

What methods are most effective for analyzing LAG2 enzymatic activity in vitro?

Analyzing LAG2 enzymatic activity requires specialized approaches due to its role in sphingolipid metabolism. The following methodological framework is recommended:

  • Substrate Preparation:

    • Synthetic sphingoid bases (sphinganine or sphingosine)

    • Acyl-CoAs of varying chain lengths (C16-C26)

    • Radiolabeled substrates ([³H] or [¹⁴C]) for high sensitivity assays

  • Reaction Conditions:

    • Buffer optimization: 50 mM HEPES (pH 7.4), 5 mM MgCl₂, 0.5 mM DTT

    • Detergent inclusion: 0.1% Triton X-100 or 0.05% n-dodecyl β-D-maltoside

    • Temperature: 30°C for most assays

    • Reaction time: 30-60 minutes (establish linearity range)

  • Activity Measurement Techniques:

    TechniqueAdvantagesLimitationsDetection Limit
    Radiolabeled substrate assayHigh sensitivity, quantitativeRequires specialized handling0.1-1 pmol
    LC-MS/MSNo radioactivity, identifies productsExpensive equipment, complex setup5-10 pmol
    Fluorescent substratesReal-time monitoring possibleLimited substrate options10-50 pmol
    Coupled enzyme assaysContinuous monitoringPotential interference50-100 pmol
  • Product Analysis:

    • Thin layer chromatography for basic separation

    • HPLC for more precise quantification

    • LC-MS/MS for definitive product identification and structural analysis

  • Controls and Validations:

    • Negative controls: heat-inactivated enzyme, reaction without enzyme

    • Positive control: known ceramide synthase (e.g., yeast LAG1 protein)

    • Inhibitor studies: fumonisin B1 (specific ceramide synthase inhibitor)

When analyzing substrate specificity, researchers should systematically test various acyl-CoA chain lengths to determine LAG2's preferences, which may differ from other LAG homologs as seen in the divergent specificities between yeast LAG1 and LAC1 .

How does LAG2 contribute to sphingolipid biosynthesis in Arabidopsis thaliana?

LAG2, as a homolog of yeast LAG1, functions as a ceramide synthase in the sphingolipid biosynthesis pathway of Arabidopsis thaliana. The protein catalyzes the N-acylation of sphingoid bases (primarily long-chain bases like sphinganine) with specific acyl-CoAs to form ceramides . This is a critical step in sphingolipid metabolism, as ceramides serve as the backbone for more complex sphingolipids.

The specific role of LAG2 can be understood through several aspects:

  • Substrate Specificity:
    LAG2 likely exhibits preferences for specific sphingoid bases and acyl-CoA chain lengths, similar to how yeast LAG1 and LAC1 show distinct substrate specificities despite catalyzing the same reaction . This specificity contributes to the diversity of ceramide species produced in plant cells.

  • Subcellular Localization:
    Like other ceramide synthases, LAG2 is primarily localized to the endoplasmic reticulum (ER) membrane, where most sphingolipid biosynthesis occurs. The protein contains multiple transmembrane domains typical of the LAG1 family .

  • Functional Context:
    Sphingolipid biosynthesis in plants is critical for:

    • Membrane structure and integrity

    • Response to environmental stresses

    • Transport of GPI-anchored proteins

    • Regulation of programmed cell death

The importance of LAG2 in sphingolipid metabolism is highlighted by studies of related LAG1 homologs, which demonstrate that these proteins facilitate the ER-to-Golgi transport of glycosylphosphatidylinositol (GPI)-anchored proteins . This transport process is dependent on de novo sphingolipid synthesis, creating a functional link between ceramide production and protein trafficking.

What is the relationship between LAG2 and plant longevity or stress resistance?

The relationship between LAG2 and plant longevity or stress resistance stems from its role in sphingolipid metabolism, which is intricately connected to stress response pathways in plants. Based on the functions of LAG1 homologs in other systems, we can infer several mechanisms through which LAG2 influences plant stress resistance:

  • Sphingolipid-Mediated Stress Signaling:
    Ceramides and other sphingolipid metabolites function as second messengers in stress response pathways. LAG2-produced ceramides likely participate in signaling cascades that regulate:

    • Programmed cell death (PCD) in response to pathogens

    • Adaptation to temperature stress

    • Responses to drought conditions

    • Oxidative stress management

  • Membrane Integrity During Stress:
    Sphingolipids produced through LAG2 activity contribute to membrane stability under stress conditions by:

    • Altering membrane fluidity

    • Creating specialized membrane microdomains (lipid rafts)

    • Protecting cellular components from damage during temperature fluctuations

  • Pathogen Resistance:
    Studies of the tomato LAG1 homolog (Asc-1) demonstrate that these genes can mediate resistance to sphinganine-analog mycotoxins (SAMs) produced by phytopathogenic fungi . In tomato, the Asc-1 gene determines resistance to SAM-induced apoptosis, while susceptibility is associated with a mutant Asc-1 . This suggests LAG2 may play a similar role in Arabidopsis, potentially contributing to pathogen resistance through:

    • Prevention of toxin-induced cell death

    • Maintenance of sphingolipid homeostasis during pathogen attack

    • Salvage mechanisms in sphingolipid-depleted cells

  • Developmental Longevity:
    The connection to the yeast longevity assurance gene (LAG1) suggests LAG2 may influence plant cellular lifespan through:

    • Regulation of age-associated sphingolipid metabolism

    • Influence on senescence pathways

    • Control of developmental transitions

The name "longevity assurance gene" reflects the observation that mutations in these genes affect lifespan in yeast . While the exact mechanisms by which LAG2 influences plant longevity require further investigation, the conservation of these genes across eukaryotes suggests fundamental roles in cellular aging processes.

How do copy number variations of LAG2 affect phenotypic traits in different Arabidopsis ecotypes?

Copy number variations (CNVs) of genes can significantly impact their expression levels and subsequent phenotypic outcomes. While the provided search results don't specifically address LAG2 CNVs, we can derive insights from general principles of CNV effects in Arabidopsis and studies of related genes .

Analysis of CNVs in Arabidopsis populations reveals high plasticity of the genome, with CNVs affecting numerous genes including those involved in basic cellular functions . For LAG2, potential phenotypic impacts of CNVs might include:

  • Altered Sphingolipid Profiles:

    • Increased copy number may lead to higher ceramide synthase activity and altered sphingolipid composition

    • Changes in specific ceramide species depending on LAG2's substrate specificity

    • Potential imbalances in membrane lipid ratios affecting cellular functions

  • Ecotype-Specific Adaptations:
    Different Arabidopsis ecotypes originate from diverse geographical locations with varying environmental stresses. CNVs of LAG2 might correlate with:

    • Temperature adaptation (higher copy numbers in regions with temperature extremes)

    • Drought tolerance (modified sphingolipid profiles affecting water retention)

    • Pathogen resistance (enhanced protection against specific regional pathogens)

  • Developmental Variations:
    LAG2 CNVs could influence:

    • Flowering time alterations

    • Seed development parameters

    • Senescence timing and progression

  • Molecular Consequences of LAG2 CNVs:

    Copy NumberPotential Molecular EffectsPossible Phenotypic Outcomes
    Increased (>2)Enhanced ceramide production, Altered sphingolipid ratiosStress tolerance, Modified membrane properties, Changed signaling dynamics
    Decreased (<2)Reduced ceramide synthesis, Compensatory upregulation of other LAG homologsDevelopment delays, Stress sensitivity, Altered cell death responses
    Complete deletionReliance on other ceramide synthases, Major sphingolipid profile changesSevere phenotypes if not compensated, Potential lethality

To thoroughly investigate LAG2 CNVs across ecotypes, a recommended methodological approach would include:

  • Quantitative PCR or digital droplet PCR for precise copy number determination

  • Whole genome sequencing to identify the exact structure of duplications/deletions

  • Expression analysis correlated with copy number

  • Lipidomic profiling to assess sphingolipid composition changes

  • Phenotypic characterization under various stress conditions

This multi-layered analysis would provide insights into how LAG2 CNVs contribute to adaptive traits in different Arabidopsis populations.

What are the challenges and solutions in studying LAG2 interactions with other proteins in the sphingolipid biosynthesis pathway?

Studying protein interactions of transmembrane proteins like LAG2 presents unique technical challenges. Here's a comprehensive analysis of the challenges researchers face when investigating LAG2 interactions and potential solutions:

Challenges:

  • Transmembrane Nature:
    LAG2, like other LAG family proteins, contains multiple transmembrane domains , making it difficult to solubilize while maintaining native structure and interactions.

  • Transient Interactions:
    Many enzyme-substrate or regulatory interactions in metabolic pathways are transient and difficult to capture with standard methods.

  • Complex Lipid Environment:
    LAG2 functions within lipid membranes, and its interactions may depend on specific lipid compositions that are difficult to replicate in vitro.

  • Low Expression Levels:
    Sphingolipid biosynthetic enzymes are often expressed at relatively low levels, making detection of interaction partners challenging.

  • Limited Availability of Antibodies:
    There are few commercially available antibodies specific to plant LAG proteins, complicating immunoprecipitation approaches.

Methodological Solutions:

  • Membrane Protein-Specific Approaches:

    • Membrane Yeast Two-Hybrid (MYTH): Modified Y2H system designed specifically for membrane proteins

    • Split-Ubiquitin System: Allows detection of interactions between transmembrane proteins in their native membrane environment

    • Bimolecular Fluorescence Complementation (BiFC): Visualizes protein interactions in living plant cells

  • Advanced Biochemical Methods:

    • Chemical Crosslinking Coupled with Mass Spectrometry: Captures transient interactions before solubilization

    • Proximity-Dependent Biotin Identification (BioID): Identifies proteins in close proximity to LAG2 in living cells

    • Microscale Thermophoresis: Measures interactions in solution with minimal sample consumption

  • Reconstitution Systems:

    • Nanodiscs: Provide a native-like membrane environment for studying LAG2 interactions

    • Liposome Reconstitution: Incorporates purified LAG2 into defined lipid environments

  • Genetic Approaches:

    • Synthetic Genetic Array Analysis: Identifies genetic interactions that may reflect physical protein interactions

    • Suppressor Screens: Identify genes that when mutated suppress LAG2 mutation phenotypes

  • Computational Prediction and Validation:

    • Protein-Protein Interaction Prediction: Uses structural and evolutionary information to predict interaction partners

    • Co-expression Analysis: Identifies genes with similar expression patterns as potential interaction partners

Recommended Experimental Workflow:

  • Initial identification of candidate interactors using affinity purification-mass spectrometry with optimized detergents for membrane proteins

  • Validation of top candidates using multiple complementary methods (BiFC, split-ubiquitin, co-immunoprecipitation)

  • Functional validation through genetic studies (double mutants, overexpression)

  • Structural characterization of confirmed interactions

This comprehensive approach addresses the various challenges in studying LAG2 protein interactions while providing multiple layers of validation to ensure biological relevance.

How can knowledge of Arabidopsis LAG2 inform understanding of human ceramide synthases and associated diseases?

The evolutionary conservation of LAG homologs across eukaryotes provides a valuable opportunity to translate findings from Arabidopsis to human health contexts. Ceramide synthases play critical roles in human health, with dysregulation linked to various diseases:

The fundamental role of ceramides in cellular processes such as apoptosis, proliferation, and stress responses is conserved from plants to humans, making Arabidopsis LAG2 research valuable for broader understanding of these essential lipid pathways in human health and disease.

What potential biotechnological applications exist for manipulating LAG2 expression in crop plants?

Manipulating LAG2 expression in crop plants offers several promising biotechnological applications, given the critical roles of sphingolipids in plant stress responses, development, and cellular function:

  • Enhanced Stress Resistance:
    Modification of LAG2 expression could potentially improve crop tolerance to various stresses through altered sphingolipid profiles:

    • Drought Resistance: Sphingolipids influence membrane properties and water retention capabilities. Optimized LAG2 expression might enhance cellular membrane stability under water-limited conditions.

    • Temperature Stress: Ceramides with specific acyl chain compositions affect membrane fluidity at different temperatures. LAG2 manipulation could optimize membrane composition for specific growth environments.

    • Pathogen Resistance: Based on the role of the tomato LAG1 homolog (Asc-1) in mediating resistance to sphinganine-analog mycotoxins , LAG2 modification might enhance resistance to fungal pathogens that produce similar toxins.

  • Improved Crop Nutritional Value:
    Sphingolipids are bioactive compounds with potential health benefits:

    • Enhanced Sphingolipid Content: Upregulation of LAG2 in edible plant parts could increase ceramide and complex sphingolipid content, potentially providing health benefits to consumers.

    • Optimized Fatty Acid Profiles: Given that ceramide synthases have specificity for certain fatty acyl-CoAs, LAG2 engineering could be used to modify the fatty acid composition of sphingolipids.

  • Developmental Improvements:
    LAG2 modification could potentially influence important developmental traits:

    • Senescence Regulation: Given the connection to longevity assurance, LAG2 manipulation might delay senescence in leaves or fruits, extending shelf life.

    • Seed Development: Sphingolipids play roles in embryo development, suggesting LAG2 might be targeted to improve seed vigor or germination rates.

  • Methodological Approaches for LAG2 Manipulation:

    ApproachTechnical DetailsPotential ApplicationsConsiderations
    CRISPR/Cas9 editingPrecise modification of LAG2 coding or regulatory regionsAlter substrate specificity, expression timingRequires careful off-target analysis
    OverexpressionUse of strong constitutive or tissue-specific promotersIncrease ceramide production in specific tissuesMay cause unintended metabolic effects
    RNAi/miRNAPost-transcriptional silencingReduce LAG2 activity in specific contextsVariable efficiency across species
    Promoter manipulationModifying endogenous regulatory elementsFine-tune expression patternsRequires detailed knowledge of regulatory regions
    Protein engineeringStructure-guided mutations to alter enzyme propertiesModified substrate specificity or activityNeeds structural information
  • Commercial Development Pathway:
    For practical application in agriculture, LAG2 modification would need to follow a development pathway including:

    • Proof-of-concept in model plants

    • Comprehensive phenotypic characterization

    • Field trials under various environmental conditions

    • Metabolomic analysis to confirm desired sphingolipid profile changes

    • Safety assessment of modified plants

  • Potential Challenges:

    • Pleiotropic effects due to sphingolipids' roles in multiple cellular processes

    • Potential growth penalties if sphingolipid metabolism is significantly altered

    • Regulatory hurdles for genetically modified crops

    • Need for tissue-specific or condition-specific expression systems

The biotechnological potential of LAG2 manipulation represents an understudied area that could contribute to addressing agricultural challenges through targeted modification of the plant sphingolipidome.

What are the most promising research gaps to address in LAG2 function and regulation?

Despite advances in understanding the LAG gene family, several critical knowledge gaps remain regarding LAG2 in Arabidopsis thaliana. The following research directions represent particularly promising areas for future investigation:

  • Substrate Specificity Characterization:
    A comprehensive analysis of LAG2's preferences for specific sphingoid bases and acyl-CoA chain lengths would provide fundamental insights into its biochemical function. This is particularly important given that yeast LAG1 homologs show distinct substrate specificities despite catalyzing similar reactions .

  • Regulatory Network Mapping:
    Identification of transcription factors, post-translational modifications, and environmental conditions that regulate LAG2 expression and activity remains limited. A systems biology approach integrating transcriptomics, proteomics, and metabolomics could reveal how LAG2 is regulated in different developmental contexts and stress conditions.

  • Functional Redundancy Assessment:
    The degree of functional overlap between LAG2 and other Arabidopsis LAG homologs requires clarification. Creation of single, double, and higher-order mutants, combined with complementation studies, would help determine the unique and redundant functions of each family member.

  • Protein Interaction Network:
    Identifying LAG2 interaction partners through approaches optimized for membrane proteins would provide insights into how this enzyme is integrated into broader sphingolipid metabolism and cellular signaling networks.

  • Structural Biology:
    No high-resolution structure exists for plant LAG proteins. Structural studies would provide crucial insights into substrate binding, catalytic mechanism, and potential regulatory interactions.

  • Evolutionary Functional Divergence:
    Comparative studies across plant species could reveal how LAG2 function has evolved to meet species-specific requirements, particularly in relation to stress responses and developmental processes.

  • Ceramide Signaling Pathways:
    The downstream effects of LAG2-produced ceramides on signaling pathways remain poorly characterized in plants. Identifying the specific ceramide-responsive components would help understand how sphingolipids regulate plant responses to environmental conditions.

  • Applied Research Directions:
    Translating basic knowledge of LAG2 function to applications in crop improvement, particularly for stress resistance and nutritional enhancement, represents an important direction for future research.

Addressing these research gaps would significantly advance our understanding of sphingolipid metabolism in plants and potentially open new avenues for crop improvement and biomedicine.

How might emerging technologies advance our understanding of LAG2 function in plant biology?

Emerging technologies are poised to transform our understanding of LAG2 function in Arabidopsis and other plant species. These cutting-edge approaches offer new ways to address long-standing questions about sphingolipid metabolism:

  • CRISPR-Based Technologies:

    • Base Editing and Prime Editing: Allows precise nucleotide changes without double-strand breaks, enabling subtle modifications to LAG2 protein structure to study structure-function relationships

    • CRISPRi/CRISPRa: Provides temporal control over LAG2 expression without permanent genetic changes

    • CRISPR-Cas Screens: Facilitates systematic identification of genes that interact with LAG2

  • Advanced Imaging Technologies:

    • Super-Resolution Microscopy: Enables visualization of LAG2 localization within membrane subdomains below the diffraction limit

    • Correlative Light and Electron Microscopy (CLEM): Combines functional imaging with ultrastructural context

    • Live-Cell Sphingolipid Imaging: Using novel sphingolipid probes to track ceramide dynamics in real-time

  • Single-Cell Technologies:

    • Single-Cell Transcriptomics: Reveals cell-type specific expression patterns of LAG2

    • Single-Cell Proteomics: Detects protein-level variations across cell types

    • Spatial Transcriptomics: Maps LAG2 expression in tissue context

  • Advanced Mass Spectrometry:

    • Targeted Lipidomics: Allows comprehensive profiling of ceramide species with unprecedented sensitivity

    • MALDI-Imaging Mass Spectrometry: Provides spatial distribution of sphingolipids in plant tissues

    • Crosslinking Mass Spectrometry: Identifies protein interaction interfaces with amino acid resolution

  • Computational and Systems Biology:

    TechnologyApplication to LAG2 ResearchPotential Insights
    Machine LearningPredict functional effects of LAG2 variantsStructure-function relationships
    Network AnalysisMap LAG2 in broader cellular networksSystem-level understanding
    Molecular Dynamics SimulationModel LAG2 interactions with membranesMechanistic insights into enzyme function
    Multi-omics IntegrationConnect LAG2 to phenotypes across scalesHolistic view of LAG2 biology
  • Synthetic Biology Approaches:

    • Biosensors: Develop ceramide-responsive reporters to track LAG2 activity in vivo

    • Minimal Systems: Reconstitute sphingolipid synthesis pathways in artificial membranes

    • Orthogonal Systems: Engineer non-native sphingolipid pathways to probe LAG2 function

  • Advanced Plant Phenotyping:

    • High-Throughput Phenomics: Quantitatively assess subtle phenotypes in LAG2 variants

    • Root Phenotyping Systems: Examine LAG2 roles in root development with automated imaging

    • Environmental Simulation Chambers: Test LAG2 function under precisely controlled stress conditions

  • Translational Technologies:

    • Speed Breeding: Accelerate testing of LAG2 variants in crop species

    • Field-Based Phenotyping: Assess LAG2 modifications in agricultural contexts

    • Metabolic Engineering Platforms: Optimize sphingolipid profiles for specific applications

These emerging technologies, individually or in combination, offer unprecedented opportunities to advance our understanding of LAG2 biology from molecular mechanisms to ecosystem-level impacts. The integration of multiple approaches will be particularly powerful for building a comprehensive picture of how this sphingolipid-synthesizing enzyme contributes to plant form and function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.