Recombinant Arabidopsis thaliana Ceramide synthase 1 LOH3 (LOH3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
LOH3; LAC1; At1g13580; F13B4.7; F21F23.1; Ceramide synthase 1 LOH3; CS1; CSII; Protein LONGEVITY ASSURANCE GENE ONE HOMOLOG 3; LAG One Homolog 3; LAG1 homolog 3; LAG1 longevity assurance homolog 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
LOH3
Target Protein Sequence
MGLLESVKSINWEHESSPVYQDFRVLPLFAVFFPSIRFLLDRFVFEKLAKYLIYGKHRQD MGDDTTERKKKIRKFKESAWKCVYYLSAEILALSVTYNEPWFMNTKYFWVGPGDQTWPDQ QTKLKLKLLYMFVAGFYTYSIFALVFWETRRSDFGVSMGHHIATLILIVLSYVCSFSRVG SVVLALHDASDVFLEVGKMSKYSGAERIASFSFILFVLSWIILRLIYYPFWILWSTSYEV VLELDKDKHPIEGPIYYYMFNTLLYCLLVLHIYWWVLMYRMLVKQIQDRGKLSEDVRSDS EGEDEHED
Uniprot No.

Target Background

Function
Ceramide synthase 1 (LOH3) is an essential enzyme for plant growth, promoting cell division in root meristems. It catalyzes the biosynthesis of ceramide sphingolipids with C(16) to C(28) fatty acids. These structural membrane lipids are involved in membrane trafficking, specifically in early endosomes, and cell polarity, including polar auxin transport-related proteins. LOH3 exhibits broad substrate specificity, accommodating various fatty acid chain lengths and sphingoid bases, such as long-chain base (LCB) phytosphingosine (t18:0). This enzyme plays a crucial role in resistance to sphinganine-analog mycotoxins (SAMs), like fumonisin B(1), by restoring sphingolipid biosynthesis. In ceramides-depleted cells after SAM exposure, LOH3 can rescue the transport of GPI-anchored proteins from the endoplasmic reticulum (ER) to the Golgi apparatus. Additionally, LOH3 contributes to tolerance of hypoxic conditions, especially in the dark, by promoting the formation of very-long-chain (VLC) ceramide species (22:1, 24:1, and 26:1) and VLC unsaturated ceramides. These ceramides modulate CTR1-mediated ethylene signaling, leading to the translocation of EIN2 and EIN3 from the ER to the nucleus.
Database Links

KEGG: ath:AT1G13580

STRING: 3702.AT1G13580.2

UniGene: At.28604

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed ubiquitously at low levels. Not observed in pollen.

Q&A

What is LOH3 and what is its role in Arabidopsis thaliana?

LOH3 (LONGEVITY ASSURANCE GENE ONE HOMOLOG3, At1g13580) is one of three ceramide synthases in Arabidopsis that catalyzes an N-acyltransferase reaction using fatty acyl-coenzyme A (CoA) and long-chain base (LCB) substrates to form the sphingolipid ceramide backbone . It belongs to class II ceramide synthases (CSII) and plays critical roles in sphingolipid metabolism, plant growth regulation, and immune responses . LOH3 is a target for inhibition by the mycotoxin fumonisin B1 (FB1), which has made it valuable for studying ceramide-dependent signaling pathways .

How does LOH3 differ from other ceramide synthases in Arabidopsis?

The Arabidopsis genome encodes three ceramide synthases with distinct substrate specificities:

Ceramide SynthaseClassificationPreferred SubstratesPrimary Products
LOH1 (At3g25540)Class II (CSII)Very-long-chain fatty acyl-CoA + trihydroxy LCBVLCFA/trihydroxy LCB ceramides (predominant in GIPCs)
LOH3 (At1g13580)Class II (CSII)Very-long-chain fatty acyl-CoA + trihydroxy LCBVLCFA/trihydroxy LCB ceramides (predominant in GIPCs)
LOH2 (At3g19260)Class I (CSI)Palmitoyl-CoA + dihydroxy LCBC16 fatty acid/dihydroxy LCB ceramides (enriched in GlcCer)

While LOH1 and LOH3 are structurally related and have similar substrate preferences, LOH2 is more distantly related and uses different substrates . This functional specialization allows plants to produce diverse ceramide species with distinct biological roles.

What are the specific biochemical reactions catalyzed by LOH3?

LOH3 catalyzes the following reactions using very-long-chain acyl-CoA and trihydroxy LCB substrates :

  • lignoceroyl-CoA + phytosphingosine → N-(lignoceroyl)-phytosphingosine + coenzyme A + H+

  • cerotoyl-CoA + phytosphingosine → N-(hexacosanoyl)-phytosphingosine + coenzyme A + H+

These reactions contribute to the production of sphingolipids with very-long-chain fatty acids (C20-C28), which are essential for proper membrane organization and function in plants .

What experimental approaches are most effective for studying LOH3 function?

Several complementary approaches have proven effective for studying LOH3 function:

  • Genetic manipulation: Generation of knockout mutants (e.g., T-DNA insertion lines), RNAi-mediated silencing, and overexpression lines using constitutive promoters like CaMV 35S .

  • Sphingolipid profiling: Liquid chromatography-mass spectrometry (LC-MS) analysis of sphingolipid composition in wild-type versus LOH3-modified plants to identify changes in ceramide profiles .

  • Phenotypic characterization: Assessment of growth parameters, stress responses, and programmed cell death in LOH3-modified plants compared to controls .

  • Pharmacological approaches: Use of ceramide synthase inhibitors like fumonisin B1 (FB1) to study LOH3 function through chemical genetics .

  • Gene expression analysis: Quantitative RT-PCR to measure expression levels of LOH3 and related genes in different tissues or under various conditions .

  • Biochemical assays: In vitro enzyme activity assays using recombinant LOH3 protein to determine substrate specificity and kinetic parameters .

How can researchers differentiate between LOH1 and LOH3 functions given their overlapping roles?

Differentiating between LOH1 and LOH3 functions requires strategic experimental approaches:

  • Comparative analysis of single and double mutants: Characterization of loh1, loh3, and loh1 loh3 double mutants to identify unique versus overlapping phenotypes .

  • Differential inhibitor sensitivity: LOH1-overexpressing plants show no increased resistance to FB1, whereas LOH3-overexpressing plants acquire increased resistance, indicating differential inhibitor sensitivity that can be exploited experimentally .

  • Tissue-specific expression analysis: Examination of spatial and temporal expression patterns to identify potential functional specialization .

  • Complementation studies: Introduction of LOH1 or LOH3 into respective mutant backgrounds to test functional redundancy .

  • Selective substrate utilization analysis: Comparative biochemical assays with varying acyl-CoA chain lengths and LCB hydroxylation states to identify subtle differences in substrate preference .

What are the main challenges in measuring ceramide synthase activity in plant tissues?

Researchers face several technical challenges when measuring LOH3 activity:

  • Membrane localization: As integral membrane proteins of the endoplasmic reticulum, ceramide synthases require specialized extraction and assay conditions .

  • Substrate availability: Assays require specific very-long-chain acyl-CoA and trihydroxy LCB substrates that may be difficult to obtain commercially .

  • Distinguishing between isoforms: The presence of three ceramide synthases with overlapping activities complicates the measurement of LOH3-specific activity .

  • Product detection: Sensitive analytical techniques like LC-MS/MS are required for accurate detection and quantification of ceramide products .

  • Physiological relevance: In vitro conditions may not fully recapitulate the enzyme's behavior in vivo, where it functions within a complex lipid metabolic network .

How does LOH3 overexpression affect plant growth and development?

Overexpression of LOH3 leads to several notable phenotypic changes:

These findings suggest that modulating LOH3 expression could be a potential strategy for enhancing plant growth and stress tolerance in agricultural applications .

What happens when LOH3 is disrupted in Arabidopsis?

Disruption of LOH3 function leads to various physiological and biochemical consequences:

  • Compensatory mechanisms: When LOH3 is disrupted, LOH2 expression is upregulated as a compensatory mechanism .

  • Altered sphingolipid profiles: The loh1 loh3 double mutants exhibit decreased very-long-chain fatty acid-containing ceramides and increased free trihydroxy sphingoid bases and C16 fatty acid-containing ceramides .

  • Programmed cell death: At later developmental stages, loh1 loh3 double mutants exhibit spontaneous programmed cell death .

  • Disease resistance: Interestingly, loh1 loh3 mutants show enhanced resistance to bacterial pathogens like Pseudomonas syringae pv. maculicola (Psm) DG3 .

  • EDS1/PAD4 dependence: The programmed cell death and disease resistance phenotypes are largely dependent on the lipase-like proteins EDS1 and PAD4 .

How does LOH3 contribute to plant immunity and stress responses?

LOH3 plays multiple roles in plant immunity and stress responses:

  • Pathogen resistance regulation: Loss of LOH3 (especially in combination with LOH1 disruption) enhances resistance to bacterial pathogens like Pseudomonas syringae .

  • Programmed cell death control: LOH3 helps regulate programmed cell death, with its disruption leading to spontaneous cell death that resembles hypersensitive response .

  • Sphingolipid-mediated signaling: LOH3-derived ceramides act as signaling molecules that modulate defense responses, likely through their effects on membrane properties and lipid raft formation .

  • EDS1/PAD4 pathway interaction: LOH3 functions intersect with the EDS1/PAD4 signaling pathway, a key component of plant innate immunity .

  • Salicylic acid accumulation: Altered LOH3 activity affects salicylic acid levels, connecting sphingolipid metabolism with established immune signaling networks .

What is the relationship between LOH3, fumonisin B1 resistance, and programmed cell death?

The relationship between LOH3, fumonisin B1 (FB1) resistance, and programmed cell death is complex:

  • Differential inhibition: While FB1 inhibits all three ceramide synthases, research indicates that LOH1 is most strongly inhibited, LOH2 is least inhibited, and LOH3 has intermediate sensitivity .

  • Enhanced resistance in overexpression lines: LOH3-overexpressing plants show increased resistance to FB1, presumably because higher enzyme levels can overcome competitive inhibition .

  • FB1-induced cell death pathway: FB1 treatment triggers accumulation of free long-chain bases, which in turn activate programmed cell death pathways .

  • EDS1/PAD4 involvement: FB1 triggers EDS1/PAD4-independent LCB accumulation but EDS1/PAD4-dependent cell death and subsequent immune responses .

  • LOH2-LOH3 interplay: Interestingly, loss of LOH2 enhances FB1-induced programmed cell death, suggesting that CSI (LOH2) negatively regulates signaling triggered by CSII (LOH1/3) inhibition .

How do the different ceramide species produced by LOH3 affect signaling pathways?

Different ceramide species produced by LOH3 have distinct effects on signaling pathways:

  • Very-long-chain fatty acid ceramides: LOH3-produced ceramides containing C20-C28 fatty acids promote normal growth and development, potentially through effects on membrane organization and vesicular trafficking .

  • Trihydroxy LCB-containing ceramides: These ceramides may have specific signaling roles distinct from dihydroxy LCB-containing ceramides produced by LOH2 .

  • Glycosylinositolphosphoceramides (GIPCs): The ceramide products of LOH3 are predominantly incorporated into GIPCs, which are major components of the plant plasma membrane and may regulate signaling platforms .

  • Balance between ceramide species: The ratio between different ceramide species appears crucial, with disruption of this balance triggering defense responses and programmed cell death .

  • Long-chain base accumulation: Inhibition of LOH3 leads to accumulation of free long-chain bases, which serve as bioactive molecules that trigger defense responses and programmed cell death .

What are current methods for analyzing ceramide profiles in LOH3-modified plants?

Modern analytical approaches for ceramide profiling include:

  • Lipid extraction optimization: Modified Bligh-Dyer or Folch methods specifically adapted for plant sphingolipids, often incorporating acidification steps to improve recovery of complex sphingolipids .

  • Liquid chromatography-mass spectrometry (LC-MS): High-resolution LC-MS methods, particularly using reversed-phase chromatography coupled with electrospray ionization and multiple reaction monitoring (MRM) for targeted analysis .

  • Internal standards: Incorporation of non-natural ceramide standards for accurate quantification across different ceramide species .

  • Sphingolipidomic data analysis: Specialized software platforms for processing complex sphingolipid datasets, identifying significant changes, and correlating with phenotypic data .

  • Subcellular fractionation: Methods to analyze ceramide distribution across different membrane compartments to gain insights into LOH3 function in specific organelles .

What genetic resources are available for studying LOH3 function?

Researchers have access to various genetic resources for studying LOH3:

  • T-DNA insertion lines: Publicly available knockout or knockdown lines for LOH3 from stock centers like ABRC or NASC .

  • Double and triple mutants: Various combinations of loh1, loh2, and loh3 mutants to study functional redundancy and specialization .

  • Overexpression lines: 35S:LOH3 lines that can be used to study gain-of-function phenotypes .

  • Reporter lines: Promoter:GUS or promoter:GFP constructs to study spatial and temporal expression patterns of LOH3 .

  • Inducible expression systems: Estradiol or dexamethasone-inducible systems for controlled expression of LOH3 to study immediate effects versus long-term adaptation .

  • CRISPR/Cas9 resources: Vectors and protocols optimized for creating precise mutations in LOH3 to study structure-function relationships .

How does LOH3 function integrate with Arabidopsis meiotic recombination?

While not directly implicated in meiotic recombination, sphingolipid metabolism may intersect with recombination processes:

  • Membrane organization: LOH3-derived sphingolipids contribute to membrane structure, which could influence the organization of meiotic machinery .

  • DNA repair connections: Both sphingolipid metabolism and meiotic recombination involve responses to DNA damage, suggesting potential regulatory connections .

  • Chromosome dynamics: Altered membrane composition due to LOH3 disruption might affect chromosome movement and pairing during meiosis, although direct evidence is limited .

  • Recombination hotspots: Regions with high rates of structural variation in the Arabidopsis genome ("HOT regions") show suppressed meiotic recombination, though connections to sphingolipid metabolism remain speculative .

  • DNA damage response: Unlike AtXrcc3 (which plays essential roles in meiosis and recombination), LOH3 has not been directly implicated in DNA repair or recombination processes, indicating functional separation between these pathways .

What can recombinant LOH3 expression systems tell us about enzyme function?

Recombinant expression systems provide valuable insights into LOH3 function:

  • Heterologous expression: Expression in yeast lacking endogenous ceramide synthases has confirmed LOH3's preference for very-long-chain acyl-CoA and trihydroxy LCB substrates .

  • Structure-function analysis: Recombinant systems allow for site-directed mutagenesis to identify critical residues for substrate binding and catalysis .

  • Biochemical characterization: Purified recombinant LOH3 enables determination of kinetic parameters and inhibitor sensitivity in a controlled environment .

  • Protein-protein interactions: Recombinant systems facilitate the identification of potential protein-protein interactions that might regulate LOH3 activity in vivo .

  • Inhibitor screening: Recombinant LOH3 can be used to screen for novel, specific inhibitors with potential applications in research and agriculture .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.