Recombinant Arabidopsis thaliana Lipid phosphate phosphatase 2 (LPP2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during production. To request a specific tag, please specify it in your order; we will prioritize its development.
Synonyms
LPP2; PAP2; At1g15080; F9L1.2; Lipid phosphate phosphatase 2; AtLPP2; Phosphatidic acid phosphatase 2; AtPAP2; Prenyl diphosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
LPP2
Target Protein Sequence
MPEIHLGAHTIRSHGVTVARFHMHDWLILLLLIVIEIVLNVIEPFHRFVGEDMLTDLRYP LQDNTIPFWAVPLIAVVLPFAVICVYYFIRNDVYDLHHAILGLLFSVLITGVITDAIKDA VGRPRPDFFWRCFPDGIGIFHNVTKNVLCTGAKDVVKEGHKSFPSGHTSWSFAGLGFLSL YLSGKIRVFDQRGHVAKLCIVILPLLVAALVGVSRVDDYWHHWQDVFGGAIIGLTVATFC YLQFFPPPYDPDGWGPHAYFQMLADSRNDVQDSAGMNHLSVRQTELESVR
Uniprot No.

Target Background

Function
Arabidopsis thaliana Lipid Phosphate Phosphatase 2 (LPP2) may play a general housekeeping role in lipid metabolism. It exhibits both diacylglycerol pyrophosphate (DGPP) phosphatase and phosphatidate (PA) phosphatase activities without substrate preference. LPP2 may also function downstream of the ABA signaling pathway during seed germination and stomatal movement in leaves.
Gene References Into Functions
  1. AtLPP2 is involved in ABA signaling and regulates stomatal movement. PMID: 21277215
  2. Two AtLPP2 T-DNA insertional mutants (lpp2-1 and lpp2-2) demonstrated ABA hypersensitivity and significant PA accumulation during germination. PMID: 15960620
Database Links

KEGG: ath:AT1G15080

STRING: 3702.AT1G15080.1

UniGene: At.24540

Protein Families
PA-phosphatase related phosphoesterase family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in roots, stems, leaves, buds, flowers and siliques.

Q&A

What is Arabidopsis thaliana Lipid phosphate phosphatase 2 (LPP2) and what is its genomic location?

LPP2 (At1G15080) is an enzyme belonging to the PA-phosphatase related phosphoesterase family that catalyzes the dephosphorylation of diacylglycerol pyrophosphate (DGPP) and phosphatidic acid (PA). The gene is located on chromosome 1 of Arabidopsis thaliana and encodes a protein of 290 amino acids. LPP2 is also known by several synonyms including ATLPP2, ATPAP2, and PHOSPHATIDIC ACID PHOSPHATASE 2 . The protein plays both a general role in lipid metabolism and has specific functions in hormone signaling pathways, particularly in abscisic acid (ABA) responses .

What are the primary functions of LPP2 in Arabidopsis thaliana?

LPP2 serves multiple functions in Arabidopsis:

  • Enzymatic activity: It exhibits both diacylglycerol pyrophosphate (DGPP) phosphatase and phosphatidic acid (PA) phosphatase activities with no preference for either substrate .

  • Lipid metabolism: LPP2 plays a "housekeeping role" in general lipid metabolism by regulating levels of key signaling lipids .

  • ABA signaling: LPP2 is an integral component of the abscisic acid signaling pathway, with its expression being down-regulated by ABA .

  • Stomatal regulation: It participates in the regulation of stomatal movements in response to environmental stimuli, affecting plant water relations .

Studies with LPP2 knockout mutants (Atlpp2-2) have provided clear evidence of these functions, showing altered PA levels, modified PAK activity, and decreased sensitivity of stomata to ABA-induced closure .

How does LPP2 interact with the plant hormone abscisic acid (ABA)?

The relationship between LPP2 and ABA involves a complex regulatory network:

  • Expression regulation: ABA treatment down-regulates LPP2 expression, suggesting a feedback mechanism within the signaling pathway .

  • Metabolite regulation: In LPP2 knockout mutants (Atlpp2-2), plants contain approximately twice as much phosphatidic acid (PA) as wild-type Col-0, indicating that LPP2 controls PA levels that function as secondary messengers in ABA signaling .

  • Enzyme activity modulation: While ABA stimulates diacylglycerol kinase (DGK) activity independently of LPP2, the ABA-stimulation of PA kinase (PAK) activity observed in wild-type plants is dependent on LPP2 .

  • Physiological effects: Experiments on stomatal function revealed that Atlpp2-2 mutants show reduced sensitivity to ABA-mediated inhibition of stomatal opening, though both wild-type and mutant plants accumulate ABA to the same extent during water stress .

These findings establish LPP2 as a critical component of the ABA signaling pathway that affects both lipid metabolism and physiological responses to environmental stresses.

What approaches can be used to express and purify recombinant LPP2?

While the search results don't provide a specific protocol for LPP2 purification, an effective approach based on similar proteins can be outlined:

Expression Systems:

  • Bacterial systems (E. coli) with fusion tags (GST or His) for ease of purification

  • Plant-based expression using Agrobacterium-mediated transformation and the floral dip method for maintaining native post-translational modifications

Purification Strategy:

  • Cell lysis in a buffer containing:

    • 50 mM Tris-HCl (pH 7.5)

    • 150 mM NaCl

    • 1 mM EDTA

    • 1 mM DTT

    • Protease inhibitor cocktail

  • Affinity chromatography using:

    • GST-tagged LPP2: Glutathione Sepharose columns

    • His-tagged LPP2: Ni-NTA resin

  • Further purification steps:

    • Ion exchange chromatography

    • Size exclusion chromatography for final polishing

Validation:

  • SDS-PAGE for purity assessment

  • Western blotting using LPP2-specific antibodies

  • Activity assays using DGPP or PA as substrates

How can CRISPR-Cas systems be utilized to study LPP2 function?

CRISPR-Cas technology offers powerful approaches for investigating LPP2 function through precise genomic modifications:

Gene Editing Options:

  • Complete gene knockout: Design gRNAs targeting exons of LPP2 to create frameshift mutations or large deletions.

  • Domain-specific mutations: Create point mutations in catalytic domains to study structure-function relationships.

  • Promoter modifications: Edit regulatory regions to alter expression patterns.

  • Fluorescent protein fusions: Insert tags like YFP or HA for protein localization studies .

Methodological Approach:

  • Design Cas protein and gRNA constructs targeting LPP2-specific genomic positions .

  • Extract genomic DNA from transformed plants and screen for mutations using PCR amplification followed by sequencing .

  • Analyze editing outcomes using next-generation sequencing to characterize mutations comprehensively:

    • Deletions (most common outcome)

    • Insertions

    • Substitutions

    • Inversions

This approach allows for precise manipulation of the LPP2 gene to determine its function in various physiological and developmental contexts.

What assays can be used to measure LPP2 enzymatic activity?

Several biochemical approaches can be employed to assess LPP2 phosphatase activity:

1. Soluble PAP Activity Assay:

  • Prepare leaf or tissue extracts in an appropriate buffer

  • Separate soluble fraction by centrifugation

  • Incubate with substrate (PA or DGPP)

  • Measure release of inorganic phosphate using colorimetric methods

  • Compare activity between wild-type and mutant samples (similar to the approach used for PAH1/PAH2)

2. Radiolabeling Assay:

  • Label plant tissues with [32P]-phosphate

  • Extract lipids and separate by thin-layer chromatography

  • Quantify radiolabeled PA and dephosphorylated products

  • Calculate conversion rates to determine enzyme activity

3. Substrate Specificity Analysis:

  • Incubate purified LPP2 with various substrates (PA, DGPP)

  • Measure reaction rates under identical conditions

  • Determine kinetic parameters (Km, Vmax) for each substrate

  • Compare relative activity to establish substrate preferences

4. In vivo Activity Assessment:

  • Generate plants with altered LPP2 expression (overexpression/knockdown)

  • Measure changes in target metabolite levels (PA, DGPP)

  • Assess downstream effects on related enzymes (PAK, DGK)

  • Correlate with physiological responses (e.g., stomatal movements)

These complementary approaches provide a comprehensive assessment of LPP2 activity from basic enzymatic function to more complex physiological roles.

How does LPP2 interact with other proteins in lipid metabolism pathways?

LPP2 functions within an interconnected network of lipid metabolism proteins. Analysis of protein interaction data reveals several key partners:

Table 2: LPP2 Protein Interaction Network

ProteinInteraction ScoreFunctionReference
PAH10.977Phosphatidate phosphatase; represses phospholipid biosynthesis at ER
PAH20.975Phosphatidate phosphatase; functions redundantly with PAH1
DGAT2Not specifiedDiacylglycerol O-acyltransferase; involved in TAG synthesis

These interactions suggest LPP2 functions within a coordinated enzyme network regulating lipid metabolism, particularly:

  • Membrane lipid remodeling: LPP2 likely works with PAH1 and PAH2 in the pathway of galactolipid synthesis, which is essential for adapting to phosphate starvation .

  • Signal transduction: LPP2 interacts with components of the ABA signaling pathway, affecting PA kinase (PAK) activity but not diacylglycerol kinase (DGK) activity .

  • Lipid homeostasis: The high interaction scores with PAH1 and PAH2 indicate cooperative roles in maintaining proper balance between different lipid species in plant cells .

The functional significance of these interactions is evident in knockout studies, where disruption of single components affects the entire pathway's functionality.

What are the phenotypic consequences of LPP2 knockout or overexpression?

Genetic manipulation of LPP2 expression produces distinct phenotypes that reveal its functional importance:

LPP2 Knockout (Atlpp2-2) Phenotypes:

Potential Overexpression Effects:
While the search results don't specifically address LPP2 overexpression, we can infer likely outcomes:

  • Reduced PA levels due to enhanced dephosphorylation activity

  • Potentially hypersensitive ABA responses in stomatal regulation

  • Altered membrane lipid composition affecting cellular processes

These phenotypic changes highlight LPP2's dual role in general lipid metabolism and specific signaling pathways, particularly in stress responses.

How does LPP2 function change under different environmental stresses?

LPP2's activity and function are significantly modulated by environmental stresses, particularly through its involvement in stress hormone signaling:

Drought and Water Stress:
Under water-limiting conditions, ABA signaling becomes activated, which down-regulates LPP2 expression . This regulatory change alters PA levels and PAK activity, ultimately affecting stomatal aperture and water conservation. The Atlpp2-2 mutant shows reduced sensitivity to ABA-mediated stomatal closure, indicating LPP2's importance in drought adaptation .

Phosphate Starvation:
While not directly demonstrated for LPP2, its interacting partners PAH1 and PAH2 are crucial for "membrane lipid remodeling, an essential adaptation mechanism for plants to circumvent Pi starvation" . Given LPP2's high interaction scores with these proteins, it likely contributes to phosphate stress responses.

Flooding Response:
Search result identifies "a stress recovery signaling network for enhanced flooding tolerance in Arabidopsis," which involves regulation of "ROS homeostasis, stomatal aperture, and senescence" . Since LPP2 affects stomatal function, it may participate in this recovery network.

Temporal Dynamics:
Environmental stress responses often involve complex temporal regulation:

  • Initial stress perception and signaling

  • Adaptive metabolic adjustments

  • Recovery phase responses

How can Traffic Lines (TL) be employed to study LPP2 genetic interactions?

Traffic Lines provide a powerful visual system for genetic analysis of LPP2 interactions:

Methodological Approach:

  • Create LPP2-specific Traffic Lines by establishing plants with:

    • pNAP::eGFP marker linked to LPP2

    • pNAP::DsRed marker at a defined genetic distance from LPP2

  • Cross these TLs with plants containing mutations in candidate interacting genes.

  • Select seeds based on fluorescence patterns:

    • Green fluorescent seeds: Contain LPP2 region without the mutation

    • Red fluorescent seeds: Contain the mutation without LPP2

    • Dual fluorescent seeds: Contain both the LPP2 region and the mutation

    • Non-fluorescent seeds: Contain neither

  • Analyze phenotypes of each seed class to determine genetic interactions.

Applications for LPP2 Research:

  • Identifying synthetic lethal interactions by observing which genetic combinations fail to produce viable seeds

  • Studying enhancer/suppressor relationships by examining how mutations modify LPP2-associated phenotypes

This visual marker system significantly accelerates genetic studies of LPP2 interactions, enabling more comprehensive mapping of its functional network.

How should researchers interpret changes in LPP2 expression across different tissues and conditions?

When analyzing LPP2 expression data, researchers should consider multiple contextual factors:

Tissue-Specific Patterns:
LPP2 functions may vary across different plant tissues. For example, its role in stomatal regulation indicates specialized function in guard cells . Expression patterns should be interpreted in light of the tissue's metabolic and signaling requirements.

Developmental Context:
Like other regulatory genes in Arabidopsis, LPP2 expression may change during development. For comparison, TTN5 (another regulatory protein) is "strongly expressed during early embryo development where cell division, elongation and differentiation take place," suggesting its role in "fundamental processes, especially when cells grow and divide" .

Stress Response Dynamics:
LPP2 expression is down-regulated by ABA , indicating its integration in stress signaling. Expression changes should be evaluated across different time points of stress exposure to understand temporal dynamics of regulation.

Interpretation Framework:

  • Compare expression across multiple conditions to establish baseline versus stress-induced patterns

  • Correlate expression changes with phenotypic or metabolic shifts

  • Consider expression in the context of interacting partners (PAH1, PAH2, etc.)

  • Validate expression changes with protein levels and enzymatic activity measurements

Researchers should avoid interpreting expression data in isolation, instead integrating it with biochemical, physiological, and genetic evidence to build a comprehensive understanding of LPP2 function.

What bioinformatic tools are most effective for analyzing LPP2 sequence variation across Arabidopsis accessions?

Several bioinformatic approaches can be employed to analyze LPP2 sequence variation:

Sequence Analysis Tools:

  • Multilocus Analysis: Using "a large empirical data set (LED) as well as multilocus coalescent simulations" to analyze sequence variation in the context of genome-wide patterns .

  • Neutrality Tests: Applying statistical measures to detect selective pressures:

    • Tajima's D: Compares segregating sites to average pairwise differences

    • Fu's F(S): Evaluates allele numbers against expectations

    • Fay and Wu's H: Detects selective sweeps through derived allele frequencies

  • Variant Calling Pipelines: Tools like the "BBMap package" for sequence alignment and calling variants (deletions, insertions, substitutions) .

Analysis Framework:

When examining LPP2 sequence variation across accessions, researchers should:

  • Compare LPP2 variation patterns to genome-wide patterns to distinguish gene-specific selection from demographic effects

  • Analyze coding regions separately from regulatory regions, as they may show different evolutionary patterns

  • Correlate sequence variation with functional differences across accessions

  • Consider the "complex demographic history" of Arabidopsis when interpreting variation patterns

The empirical distribution approach is particularly valuable, as it allows researchers to determine if "the level (Watterson's theta) and pattern of variation (Tajima's D) detected in these loci did not deviate either at the single-locus or multilocus level from the corresponding empirical distributions" .

How can contradictory data about LPP2 function be reconciled?

When faced with seemingly contradictory findings about LPP2 function, researchers should consider multiple factors that might explain discrepancies:

Experimental Context Differences:

  • Plant growth conditions (light, temperature, humidity)

  • Developmental stage of plants used in experiments

  • Specific tissues examined

  • Duration and intensity of treatments applied

Genetic Background Effects:
Arabidopsis thaliana has "a complex demographic history" that shapes genetic variation . Different accessions might exhibit different LPP2 behaviors due to:

  • Sequence variations in LPP2 itself

  • Differences in interacting partners or regulatory elements

  • Genetic modifiers present in specific backgrounds

Methodological Considerations:
Various techniques provide different windows into LPP2 function:

  • In vitro enzymatic assays reveal biochemical properties

  • In vivo studies capture physiological roles

  • Genetic approaches highlight functional relationships

Reconciliation Strategies:

  • Comparative experiments: Replicate key experiments under identical conditions with multiple accessions

  • Context-specific models: Develop models that account for LPP2's multiple functions in different contexts rather than seeking a single unified function

  • Statistical validation: Apply robust statistical methods to distinguish significant findings from random variation

By systematically addressing these factors, researchers can often transform apparently contradictory data into a more nuanced understanding of LPP2's multifaceted roles in plant biology.

What emerging technologies could advance our understanding of LPP2 function?

Several cutting-edge approaches show promise for deepening our understanding of LPP2:

Advanced Genome Editing:

  • Prime editing technologies for precise nucleotide changes without double-strand breaks

  • Multiplex CRISPR systems to simultaneously modify LPP2 and interacting partners

  • Inducible or tissue-specific CRISPR systems for temporal and spatial control of LPP2 expression

Single-Cell Technologies:

  • Single-cell RNA sequencing to map LPP2 expression across different cell types

  • Single-cell proteomics to track LPP2 protein levels and modifications

  • Single-cell metabolomics to monitor LPP2-dependent lipid changes at cellular resolution

Advanced Imaging:

  • Super-resolution microscopy for precise subcellular localization

  • Biosensors for real-time monitoring of LPP2 activity and lipid dynamics

  • FRET-based approaches to visualize protein-protein interactions involving LPP2

Systems Biology Approaches:

  • Mathematical modeling of LPP2-dependent lipid metabolism

  • Network analysis integrating transcriptomic, proteomic, and metabolomic data

  • Machine learning to predict LPP2 function across different genetic backgrounds and conditions

Translation to Crop Species:

  • Identification and characterization of LPP2 orthologs in important crop plants

  • Assessment of natural variation in LPP2 function related to stress tolerance

  • Targeted modification of LPP2 and related genes to enhance crop resilience

These emerging technologies have the potential to resolve current knowledge gaps and provide a more comprehensive understanding of LPP2's multifaceted roles in plant biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.