Recombinant Arabidopsis thaliana Long-chain-alcohol oxidase FAO3 (FAO3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its inclusion.
Synonyms
FAO3; At3g23410; MLM24.14; MLM24.23; Long-chain-alcohol oxidase FAO3; Long-chain fatty alcohol oxidase 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-746
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
FAO3
Target Protein Sequence
MDKYKVAGKFGLPDITVAEMESLASFCEAVLPSVQPPPEELSGEGDNHRNKEALRSFYST SGSKTPVLRQSIELVTKRGTIEAYIATRLILFLLATRLGTLLICGTECLVSRWPFVEKFS ELSLEKRERVLQKQFKNWILTPIRAAFVYIKVAFLFCFFSRVNPNGENPAWEAIGYRVNP DENKPSETHNERPLEKGIVETMEETEQTLLESLAHKGLEAVLDTEHDAIRIKCDVVVVGS GSGGGVAASVLAKSGLKVVVLEKGSYFTPSEHRPFEGPGLDKLYENGGILPSVDGSFMVL AGATVGGGSAVNWSACIKTPKSVLQEWSEDQNIPLFGTKEYLTAMEVVWKRMGVTEKCEL ESFQNQILRKGCENLGFNVENVPRNSSESHYCGSCGYGCRQGDKKGSDRTWLVDAVGHGA VILTGCKAERFILEKNGSNKGGKQMKCLGVMAKSLNGNIAKMLKIEAKVTVSAGGALLTP PLMISSGLRNRNIGKNLHLHPVLMAWGYFPDKESSNISFKGNSYEGGIITSVSKVLSEDS EVRAIIETPQLGPGSFSVLTPWTSGLDMKKRMARYSRTASLITIVRDRGSGEVKTEGRIN YTVDKTDRDNLKAGLRESLRILIAAGAEEVGTHRSDGQRLICKGVNENSIQEFLDSVSTE EGAKGMTEKWNVYSSAHQMGSCRIGENEKEGAIDLNGESWEAEKLFVCDASALPSAVGVN PMITVMSTAYCISTRIAKSMTTGLSH
Uniprot No.

Target Background

Function

Recombinant Arabidopsis thaliana Long-chain-alcohol oxidase FAO3 (FAO3) is a long-chain fatty alcohol oxidase involved in the ω-oxidation pathway of lipid degradation.

Database Links

KEGG: ath:AT3G23410

STRING: 3702.AT3G23410.1

UniGene: At.28715

Protein Families
GMC oxidoreductase family
Subcellular Location
Membrane.

Q&A

What is Arabidopsis thaliana Long-chain-alcohol oxidase FAO3 and what is its function?

Arabidopsis thaliana Long-chain-alcohol oxidase FAO3 (AtFAO3) is a membrane-bound, flavin-containing enzyme that catalyzes the oxidation of long-chain fatty alcohols to fatty aldehydes with the concurrent production of hydrogen peroxide. This enzyme represents the first functionally characterized long-chain alcohol oxidase identified in higher plants . AtFAO3 plays a critical role in the fatty alcohol oxidation pathway, which is essential for the metabolism of very-long-chain fatty alcohols before they can undergo β-oxidation . The protein has been successfully solubilized while maintaining its biological activity, which has opened avenues for detailed structural studies through crystallography .

How is AtFAO3 structurally and functionally related to similar enzymes in other plant species?

AtFAO3 shares significant sequence homology with fatty alcohol oxidases from other plant species. For instance, the jojoba (Simmondsia chinensis) FAO shares 52% identity with Arabidopsis FAO3 . This homology reflects the evolutionary conservation of the fatty alcohol oxidation pathway across different plant species. Despite this conservation, species-specific adaptations exist, as evidenced by jojoba's specialized use of this pathway for mobilizing wax ester storage reserves following seed germination . The functional conservation suggests that AtFAO3's catalytic mechanism likely resembles that of other plant FAOs, involving flavin-dependent oxidation reactions.

What are the recommended storage and handling conditions for recombinant AtFAO3 protein?

For optimal stability and activity of recombinant AtFAO3 protein, the following storage and handling conditions are recommended:

ParameterRecommendation
Storage temperature-20°C/-80°C
Working storage4°C for up to one week
Physical formLyophilized powder
Reconstitution mediumDeionized sterile water
Recommended concentration0.1-1.0 mg/mL
Stabilizing agent5-50% glycerol (final concentration)
Storage bufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Freeze-thaw cyclesAvoid repeated cycles
AliquotingNecessary for multiple use

The protein should be briefly centrifuged prior to opening to bring contents to the bottom of the vial . Proper storage and handling significantly influence enzyme stability and experimental reproducibility.

What are the critical considerations for designing expression systems for AtFAO3?

When designing expression systems for recombinant AtFAO3, researchers should consider several critical factors:

The expression of AtFAO3 in E. coli with an N-terminal His-tag yielding active enzyme demonstrates the feasibility of prokaryotic expression systems for this enzyme , but optimization may be needed depending on specific research objectives.

How can researchers effectively assay AtFAO3 enzymatic activity in vitro?

To effectively assay AtFAO3 enzymatic activity in vitro, researchers should implement a multi-faceted approach:

  • Substrate Selection: Use very-long-chain fatty alcohols (C16-C30) as substrates, as these are the physiological substrates of AtFAO3 . Common substrates include hexadecanol (C16) and octadecanol (C18).

  • Activity Measurement: Several approaches can be used:

    • Hydrogen Peroxide Detection: As AtFAO3 generates H₂O₂ during catalysis, coupling with peroxidase and a chromogenic or fluorogenic substrate allows spectrophotometric detection.

    • Fatty Aldehyde Detection: Direct measurement of fatty aldehyde formation using HPLC or GC-MS.

    • Oxygen Consumption: Measure oxygen consumption using an oxygen electrode.

  • Reaction Conditions: Optimize buffer composition, pH (typically 7.5-8.5), temperature (usually 25-30°C), and cofactor requirements.

  • Controls: Include:

    • Enzyme-free reactions to account for non-enzymatic oxidation

    • Heat-inactivated enzyme controls

    • Known FAO inhibitors to confirm specificity

  • Kinetic Analysis: Determine Km and Vmax values for different substrates to characterize substrate specificity and catalytic efficiency.

The recombinant enzyme's demonstrated retention of biological activity after solubilization facilitates these biochemical characterizations that are essential for understanding AtFAO3's catalytic properties.

What approaches can be used to study the subcellular localization of AtFAO3?

Multiple complementary approaches can be employed to accurately determine AtFAO3's subcellular localization:

  • Fluorescent Protein Fusions: GFP or other fluorescent protein fusions have been successfully used with FAO proteins. In jojoba, FAO localized to the endoplasmic reticulum when expressed as an amino-terminal GFP fusion in tobacco leaves . For Arabidopsis FAO3, similar approaches would be informative, using both N- and C-terminal fusions to ensure tag position doesn't interfere with localization signals.

  • Immunolocalization: Using specific antibodies against AtFAO3 for immunofluorescence microscopy or immunogold electron microscopy provides high-resolution localization data without the potential artifacts of overexpression.

  • Subcellular Fractionation: Differential and density gradient centrifugation followed by Western blotting or enzyme activity assays can biochemically verify localization results.

  • Co-localization Studies: Combining AtFAO3 fluorescent fusions with established organelle markers helps identify the precise subcellular compartment.

  • FRET/FLIM Analysis: For studying potential protein-protein interactions within specific subcellular compartments.

  • Proteomic Analysis: Mass spectrometry-based identification of AtFAO3 in purified organelle fractions can provide complementary evidence for localization.

The localization data should be interpreted in the context of the fatty alcohol oxidation pathway's biological role, particularly considering potential interactions with fatty aldehyde dehydrogenase (FADH), which functions downstream of FAO .

How does AtFAO3 contribute to the fatty alcohol oxidation pathway in Arabidopsis compared to other species?

AtFAO3 contributes to the fatty alcohol oxidation pathway in Arabidopsis through a specialized biochemical role that differs in certain aspects from homologous enzymes in other species:

  • Pathway Integration: In Arabidopsis, AtFAO3 catalyzes the first step in the two-step oxidation of fatty alcohols to fatty acids, followed by fatty aldehyde dehydrogenase (FADH) . This pathway is conserved but serves different physiological roles across species.

  • Physiological Role Comparison:

SpeciesPrimary FAO FunctionSubstrate SourcePhysiological Context
Arabidopsis thalianaGeneral lipid metabolismVarious sourcesMultiple developmental processes
Jojoba (Simmondsia chinensis)Wax ester mobilizationSeed storage reservesPost-germination seedling establishment
Candida cloacaeCarbon source utilizationEnvironmental fatty alcoholsNutrient acquisition
  • Catalytic Efficiency: The AtFAO3 enzyme shares 52% sequence identity with jojoba FAO , suggesting significant evolutionary conservation while allowing for species-specific optimization of catalytic parameters.

  • Regulatory Control: Unlike jojoba, where FAO expression is strongly induced during germination , Arabidopsis likely employs different regulatory mechanisms reflecting its broader metabolic roles.

  • Pathway Coupling: The efficiency of the pathway depends on the coordinated action of AtFAO3 with downstream enzymes. Co-expression of jojoba FAO and FADH in Arabidopsis enhanced fatty alcohol oxidation more than 4-fold , suggesting potential rate limitation at these steps in the native Arabidopsis pathway.

This comparative analysis highlights how evolutionarily related enzymes can serve specialized physiological roles across different plant species while maintaining core catalytic functions.

What are common challenges in expressing and purifying recombinant AtFAO3?

Researchers frequently encounter several challenges when expressing and purifying recombinant AtFAO3:

  • Inclusion Body Formation: As a membrane-associated protein, AtFAO3 may aggregate in inclusion bodies when overexpressed in E. coli. Strategies to address this include:

    • Lowering expression temperature (16-20°C)

    • Reducing inducer concentration

    • Using specialized E. coli strains designed for membrane protein expression

    • Co-expressing molecular chaperones

  • Maintaining Flavin Cofactor Association: AtFAO3 is a flavin-containing enzyme, and loss of the cofactor during purification can reduce activity. Consider:

    • Adding flavin (FAD or FMN) to culture media and purification buffers

    • Using gentle purification conditions to preserve cofactor binding

    • Reconstituting the enzyme with excess flavin after purification

  • Solubilization Challenges: Extracting functional protein from membranes requires optimization:

    • Testing different detergents (mild non-ionic detergents like DDM or Triton X-100)

    • Using optimized detergent:protein ratios

    • Implementing proper solubilization times and temperatures

  • Protein Stability Issues: Purified AtFAO3 may show reduced stability. Consider:

    • Adding stabilizing agents (glycerol, specific lipids)

    • Optimizing buffer conditions (pH, salt concentration)

    • Storing in small aliquots to avoid freeze-thaw cycles

  • Activity Preservation: The catalytic activity of AtFAO3 can be sensitive to purification conditions:

    • Include activity assays at each purification step

    • Minimize exposure to oxidizing conditions

    • Test different purification strategies to identify those that best preserve activity

Through careful optimization of these parameters, functional recombinant AtFAO3 can be successfully produced, as demonstrated by previous studies that achieved solubilization while maintaining biological activity .

How can researchers design experiments to study the physiological role of AtFAO3 in Arabidopsis?

Designing experiments to elucidate the physiological role of AtFAO3 in Arabidopsis requires a multi-faceted approach:

  • Genetic Approaches:

    • Generate and characterize knockout/knockdown mutants using T-DNA insertion lines, CRISPR/Cas9, or RNAi

    • Create overexpression lines using constitutive or inducible promoters

    • Develop tissue-specific or developmental stage-specific expression systems

    • Engineer complementation lines expressing wild-type or mutant versions in the knockout background

  • Expression Analysis:

    • Perform qRT-PCR to quantify expression across tissues and developmental stages

    • Use promoter-reporter fusions (e.g., AtFAO3promoter:GUS) to visualize expression patterns

    • Analyze publicly available transcriptomic datasets for condition-dependent expression

    • Implement single-cell RNA-seq to identify cell-specific expression patterns

  • Biochemical and Metabolic Analyses:

    • Measure fatty alcohol, aldehyde, and fatty acid levels in wild-type vs. mutant plants

    • Conduct isotope labeling experiments to track fatty alcohol metabolism

    • Perform in vitro enzyme assays with native protein extracted from different tissues

    • Use lipidomics to comprehensively profile changes in lipid composition

  • Physiological Phenotyping:

    • Assess growth and development under normal and stress conditions

    • Examine seed composition, germination efficiency, and seedling establishment

    • Test responses to exogenous fatty alcohols or related compounds

    • Monitor reproductive development and senescence

  • Interaction Studies:

    • Identify protein-protein interactions using yeast two-hybrid, co-immunoprecipitation, or proximity labeling

    • Co-express AtFAO3 with FADH to assess pathway efficiency, similar to studies with jojoba enzymes

    • Investigate regulatory interactions through chromatin immunoprecipitation or protein-DNA binding assays

By systematically implementing these approaches, researchers can build a comprehensive understanding of AtFAO3's physiological roles in Arabidopsis, extending beyond the insights gained from comparison with homologous enzymes in other species like jojoba.

What strategies can resolve contradictory data regarding AtFAO3 substrate specificity?

When faced with contradictory data regarding AtFAO3 substrate specificity, researchers should implement a systematic troubleshooting approach:

  • Standardize Experimental Conditions:

    • Establish uniform reaction conditions (buffer composition, pH, temperature, enzyme concentration)

    • Use consistent substrate preparation methods to eliminate variability from solubility issues

    • Standardize activity measurement techniques across experiments

  • Comprehensive Substrate Panel Testing:

    • Test a wide range of fatty alcohols varying in chain length (C4-C30)

    • Include both saturated and unsaturated fatty alcohols

    • Examine branched-chain and hydroxylated variants

    • Analyze substrate competition to detect preference patterns

  • Enzyme Source Comparison:

    • Compare recombinant enzyme from different expression systems (prokaryotic vs. eukaryotic)

    • Analyze native enzyme purified from Arabidopsis tissues

    • Assess the impact of different purification methods on substrate specificity

    • Evaluate the influence of fusion tags on enzymatic properties

  • Protein Structural Analysis:

    • Generate structural models based on homologous enzymes

    • Identify and mutate putative substrate-binding residues

    • Perform circular dichroism to verify proper protein folding

    • Consider X-ray crystallography or cryo-EM studies with different substrates

  • Kinetic Parameter Determination:

    • Calculate and compare Km, Vmax, and catalytic efficiency (kcat/Km) for different substrates

    • Assess product inhibition effects

    • Examine the influence of cofactors and potential allosteric regulators

    • Perform reaction progress curve analysis for deeper kinetic insights

  • In Vivo Validation:

    • Conduct in vivo feeding experiments with different fatty alcohols

    • Analyze metabolite profiles in wild-type versus AtFAO3 mutant plants

    • Implement isotope labeling to track specific substrate metabolism

    • Correlate in vitro substrate preferences with in vivo utilization patterns

By systematically addressing these aspects, researchers can resolve contradictions and develop a more nuanced understanding of AtFAO3's true substrate specificity profile, which may include both primary and secondary substrates with different catalytic efficiencies.

How can structural biology approaches enhance our understanding of AtFAO3 function?

Structural biology offers powerful approaches to deepen our understanding of AtFAO3's molecular function:

  • X-ray Crystallography: Determining the three-dimensional structure of AtFAO3 would reveal crucial insights into:

    • The architecture of the active site and substrate-binding pocket

    • The binding mode of the flavin cofactor

    • The structural basis for membrane association

    • Potential oligomerization interfaces

    The successful solubilization of AtFAO3 with retained biological activity provides a promising starting point for crystallization trials.

  • Cryo-Electron Microscopy (Cryo-EM): This approach is particularly valuable for:

    • Visualizing different conformational states during the catalytic cycle

    • Studying AtFAO3 in membrane-like environments

    • Examining large complexes involving AtFAO3 and interaction partners

    • Capturing transient structural intermediates

  • Nuclear Magnetic Resonance (NMR) Spectroscopy: Useful for:

    • Analyzing the dynamics of specific protein regions

    • Mapping protein-ligand interactions

    • Studying localized conformational changes upon substrate binding

    • Examining smaller domains if the full-length protein proves challenging

  • Computational Approaches:

    • Homology modeling based on related oxidases

    • Molecular dynamics simulations to study protein flexibility and substrate interactions

    • Quantum mechanics/molecular mechanics (QM/MM) to model the catalytic mechanism

    • Virtual screening to identify potential inhibitors or substrate analogs

  • Structure-Function Analysis:

    • Site-directed mutagenesis of predicted catalytic residues

    • Domain swapping with related FAOs to map functional regions

    • Creation of chimeric enzymes to identify substrate specificity determinants

    • Hydrogen-deuterium exchange mass spectrometry to map conformational changes

The combination of these approaches would provide unprecedented insights into how AtFAO3's structure enables its catalytic function and substrate specificity, potentially revealing novel aspects of flavin-dependent alcohol oxidation mechanisms in plants.

What are promising biotechnological applications of recombinant AtFAO3?

Recombinant AtFAO3 offers several promising biotechnological applications across different fields:

  • Biocatalysis and Green Chemistry:

    • Selective oxidation of long-chain alcohols under mild conditions

    • Production of specialty aldehydes for fragrance and flavor industries

    • Development of cascade enzymatic reactions for complex chemical synthesis

    • Creation of immobilized enzyme systems for continuous bioprocessing

  • Biosensing Applications:

    • Development of biosensors for detecting long-chain alcohols in environmental samples

    • Creation of enzyme-based assays for monitoring lipid metabolism in biological samples

    • Integration into bioelectronic devices for real-time monitoring applications

    • Coupling with other enzymes for detecting complex lipid molecules

  • Metabolic Engineering:

    • Enhancement of fatty alcohol oxidation pathways in plants for improved stress tolerance

    • Modification of oilseed crops for altered oil composition and properties

    • Engineering microorganisms for bioconversion of fatty alcohols to value-added products

    • Improving biofuel production processes through optimized fatty alcohol metabolism

  • Structural Biology Research Tools:

    • Using AtFAO3 as a model system for studying membrane-associated flavoenzymes

    • Developing novel protein engineering strategies based on AtFAO3's structure-function relationships

    • Creating reporter systems for monitoring gene expression in plants

    • Serving as a platform for directed evolution experiments to create enzymes with novel properties

  • Plant Biochemistry and Physiology Research:

    • Investigating the role of fatty alcohol metabolism in plant development

    • Studying plant responses to environmental stresses through lipid metabolism

    • Exploring the evolution of lipid metabolic pathways across different plant species

    • Developing tools for manipulating plant lipid composition

These applications leverage AtFAO3's unique properties as a membrane-bound, flavin-containing long-chain alcohol oxidase with well-characterized biochemical properties .

How can transcriptomic and proteomic approaches be used to study AtFAO3 regulation and pathway integration?

Multi-omics approaches provide powerful tools for elucidating AtFAO3 regulation and pathway integration:

  • Transcriptomic Analyses:

    • RNA-Seq across developmental stages, tissues, and stress conditions can reveal the temporal and spatial regulation patterns of AtFAO3 expression.

    • Single-cell transcriptomics can uncover cell type-specific expression patterns that might be masked in bulk tissue analysis.

    • Co-expression network analysis can identify genes that share regulatory elements with AtFAO3, suggesting functional relationships.

    • Comparative transcriptomics between Arabidopsis and species like jojoba can highlight evolutionary adaptations in fatty alcohol metabolism regulation.

  • Proteomic Approaches:

    • Quantitative proteomics can verify if transcript-level changes translate to protein abundance alterations.

    • Post-translational modification (PTM) profiling can identify regulatory modifications on AtFAO3 (phosphorylation, ubiquitination, etc.).

    • Protein turnover analysis can determine AtFAO3's half-life under different conditions.

    • Membrane proteomics can identify co-localized proteins that may functionally interact with AtFAO3.

  • Integrated Multi-omics Strategies:

    • Correlation analysis between transcripts, proteins, and metabolites related to fatty alcohol metabolism.

    • Pathway flux analysis combining expression data with metabolite measurements.

    • Systems biology modeling to predict regulatory interactions affecting AtFAO3 activity.

    • Multi-omics data integration to construct comprehensive regulatory networks.

  • Experimental Validation Approaches:

    • Chromatin immunoprecipitation sequencing (ChIP-seq) to identify transcription factors regulating AtFAO3.

    • Promoter-reporter studies to validate predicted regulatory elements.

    • CRISPR interference/activation to manipulate expression of potential regulatory factors.

    • Proximity-dependent labeling (BioID, APEX) to identify physical interaction partners.

  • Data Analysis and Integration Framework:

Data TypeAnalysis ApproachExpected Insights
TranscriptomeDifferential expressionCondition-specific regulation
Co-expression clusteringPathway coordination
eQTL mappingGenetic regulation
ProteomeAbundance quantificationPost-transcriptional regulation
Interactome mappingFunctional complexes
PTM profilingActivity regulation
MetabolomeSubstrate/product profilingPathway flux
Isotope labelingMetabolic rates
Multi-omicsNetwork reconstructionSystem-level regulation

These approaches would provide a comprehensive understanding of how AtFAO3 is regulated and integrated into broader metabolic networks, extending well beyond current knowledge that primarily focuses on basic functional characterization .

What are the optimal methods for formulating research questions about AtFAO3?

Formulating effective research questions about AtFAO3 requires a structured approach that balances specificity with broader significance:

  • Application of the PICO Framework:

    • Population: Define the biological system (Arabidopsis, specific tissues, developmental stages)

    • Intervention: Specify manipulations (gene knockout, overexpression, inhibitor treatment)

    • Control: Identify appropriate controls (wild-type, empty vector, inactive enzyme variant)

    • Outcome: Determine measurable endpoints (enzyme activity, metabolite levels, phenotypic changes)

  • Question Hierarchy Development:

    • Begin with broad, overarching questions about AtFAO3's role in plant biology

    • Develop intermediate questions addressing specific aspects (regulation, localization, substrate specificity)

    • Formulate precise, testable hypotheses that can be addressed with available methods

  • Integration of Current Knowledge Gaps:

    • Review existing literature to identify contradictions or unexplored areas

    • Consider evolutionary aspects by comparing with other species' FAO enzymes

    • Incorporate cross-disciplinary perspectives (biochemistry, genetics, physiology)

    • Evaluate technological feasibility of addressing the question

  • Examples of Well-Formulated Questions:

Question TypeExample
Basic CharacterizationHow does AtFAO3 substrate specificity compare with FAO enzymes from other plant species?
Regulatory MechanismWhat transcription factors regulate AtFAO3 expression during seed germination?
Physiological RoleHow does AtFAO3 activity contribute to Arabidopsis cold stress tolerance?
Structural InvestigationWhich amino acid residues in AtFAO3 are essential for fatty alcohol binding?
Biotechnological ApplicationCan AtFAO3 be engineered to accept non-native substrates for biocatalysis applications?
  • Evaluation Criteria for Research Questions:

    • Scientific significance and novelty

    • Technical feasibility with available methods

    • Potential for broader impact beyond the specific enzyme

    • Connection to fundamental biological principles

    • Possibility for translational applications

Following these structured approaches helps ensure that research questions about AtFAO3 are both scientifically rigorous and positioned to make meaningful contributions to plant biochemistry and molecular biology .

What resources and databases are most valuable for AtFAO3 research?

Researchers investigating AtFAO3 have access to numerous specialized resources that provide complementary data types:

  • Sequence and Structural Databases:

    • UniProt (Q9LW56): Primary resource for protein sequence and annotation information

    • Protein Data Bank (PDB): For structural data of related flavin-containing oxidases

    • AlphaFold DB: For predicted structural models of AtFAO3

    • Pfam/InterPro: For domain architecture and evolutionarily conserved regions

  • Plant-Specific Resources:

    • The Arabidopsis Information Resource (TAIR): Comprehensive genomic data, mutant information, and gene expression

    • Arabidopsis eFP Browser: Visualization tool for gene expression patterns across tissues and conditions

    • Plant Reactome: For metabolic pathway information involving fatty alcohol oxidation

    • ATTED-II: For co-expression data to identify functionally related genes

    • AraPort: Integrated data portal for Arabidopsis research

  • Functional Genomics Resources:

    • Arabidopsis Biological Resource Center (ABRC): Source for T-DNA insertion lines and other genetic materials

    • 1001 Genomes Project: Natural variation data for AtFAO3 across Arabidopsis ecotypes

    • BAR Expression Browser: Multi-dimensional gene expression data visualization

    • NCBI GEO/ArrayExpress: Repositories for transcriptomic datasets involving AtFAO3

  • Metabolic and Biochemical Databases:

    • BRENDA: Comprehensive enzyme information database

    • BioCyc/AraCyc: Metabolic pathway databases with Arabidopsis-specific information

    • LIPID MAPS: Specialized database for lipid metabolism

    • MetaboLights: Repository for metabolomics data

  • Integrated Data Resources:

Resource TypeExample ResourcesKey Information Provided
Sequence/StructureUniProt, AlphaFoldProtein sequence, predicted structure
ExpressionTAIR, eFP BrowserTissue-specific, condition-dependent expression
GeneticABRC, 1001 GenomesMutant lines, natural variation
MetabolicBRENDA, AraCycEnzyme properties, pathway context
LiteraturePubMed, Google ScholarResearch findings, methodologies
  • Specialized Tools:

    • BLAST/HMMER: For identifying homologs in other species

    • Primer3Plus: For designing primers for AtFAO3 cloning or qPCR

    • CRISPR design tools: For generating targeted mutations

    • ProtParam: For calculating physicochemical properties relevant to purification

These resources collectively provide a comprehensive information ecosystem for researchers investigating various aspects of AtFAO3 structure, function, and biological roles.

How should researchers approach interdisciplinary collaborations for comprehensive AtFAO3 studies?

Successful interdisciplinary collaborations for AtFAO3 research require deliberate planning and execution strategies:

  • Identifying Complementary Expertise:

    • Biochemists/Enzymologists: For enzyme characterization, kinetic analysis, and structural studies

    • Molecular Biologists: For gene expression analysis, promoter studies, and genetic manipulation

    • Plant Physiologists: For phenotypic analysis and physiological context

    • Analytical Chemists: For metabolite profiling and advanced structural characterization

    • Computational Biologists: For modeling, sequence analysis, and data integration

  • Establishing Clear Communication Frameworks:

    • Develop a shared vocabulary to bridge discipline-specific terminology

    • Schedule regular meetings with structured agendas

    • Create collaborative online workspaces for real-time document sharing

    • Establish clear protocols for data sharing and management

  • Designing Integrated Experimental Approaches:

Research QuestionDisciplinary ContributionsIntegration Strategy
AtFAO3 structural mechanismBiochemistry: Purified protein
Structural biology: Crystallography
Computational: Molecular dynamics
Sequential workflow with feedback loops
Physiological roleMolecular biology: Gene knockouts
Physiology: Phenotypic analysis
Metabolomics: Lipid profiling
Parallel investigations with shared samples
Evolutionary adaptationBioinformatics: Comparative genomics
Biochemistry: Enzyme characterization
Evolutionary biology: Selection analysis
Iterative hypothesis refinement
  • Managing Methodological Differences:

    • Recognize different approaches to experimental design and validation

    • Establish consensus on acceptable evidence standards

    • Develop protocols that satisfy methodological requirements across disciplines

    • Create workflows that allow for discipline-specific analyses of shared samples

  • Optimizing Resource Utilization:

    • Identify specialized equipment or expertise unique to each collaborator

    • Develop shared protocols to ensure compatibility of data

    • Establish material transfer agreements early in the collaboration

    • Consider the development of centralized databases for collaborative data

  • Publications and Authorship Considerations:

    • Discuss publication strategy early in the collaboration

    • Acknowledge disciplinary norms for authorship

    • Consider both discipline-specific and interdisciplinary publication venues

    • Establish guidelines for data presentation that satisfy all disciplines

By strategically implementing these approaches, researchers can create productive collaborations that leverage diverse expertise to comprehensively understand AtFAO3's structure, function, and biological significance beyond what would be possible within a single discipline.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.