Recombinant Arabidopsis thaliana Long-chain-alcohol oxidase FAO4A (FAO4A)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes if needed. We will accommodate requests whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your own preparations.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
FAO4A; At4g19380; T5K18.160; Long-chain-alcohol oxidase FAO4A; Long-chain fatty alcohol oxidase 4A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-726
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
FAO4A
Target Protein Sequence
MESLVAICDTFISSIDDSGVGHVDDCVAGYFSASASQTGTPDRVARLMSERLHHPKKWIL RAGLWLLSTWIGSLVLCGWRSFTGEFPYFRRFCRLPEKRREEILLNWSSSYFSLLRMLFR TIKLISALVFFTQVDEKGRNLAWKAIGYNGPSPDHSDHEVELNEEKKKKKPEEIFGPLYN GIVDLKSPREAVEKKLAGRGFAVSNQKRNTNGSSISDPVMKIQCDAVVVGSGSGGGVAAG VLAKAGYKVLVIESGNYYARSKLSLLEGQAMDDMYLSGGLLATSDTNVVILAGSTVGGGS TINWSASIKTPEHVMKEWAEKSKLEMFGSDLYREAMDVVCKRMGVQCGFVEEGFNNEVLR KGCEKLGLPVKNIPRNAPSDHYCGFCCLGCKKGQKQGTSETWLVDLVESDNGLILPGCQA TEVMYDCEQGKKKKATGVAFAFGEEIYVVESRVTIVACGALRTPHLLKRSGLKNSNIGRN LCLHPVVMAWGWFPEEDKWPEKKKKSYEGGIMTAMSSVVIEETHSSYGEMVIQTPALHPG MFSGIIPWTSSKDFKTRMLKFSRTAHIFALLRDKGTGTIDSKTYIDYNLNDEDEESLKNG LERVLKILAAAGAEEIGTHHSEGRSLNVRTASSLEIERFVREESSKPLKDLSGQICSAHQ MGSCRMGIRPEESAVRPTGETWEVERLFVADTSVFPTALGVNPMVTVQSIAYCIGLNVVD VLKKKK
Uniprot No.

Target Background

Function
Recombinant *Arabidopsis thaliana* Long-chain-alcohol oxidase FAO4A (FAO4A) is a long-chain fatty alcohol oxidase involved in the ω-oxidation pathway of lipid degradation.
Database Links

KEGG: ath:AT4G19380

STRING: 3702.AT4G19380.1

UniGene: At.32817

Protein Families
GMC oxidoreductase family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Arabidopsis thaliana Long-chain-alcohol oxidase FAO4A and what is its significance in plant metabolism?

Arabidopsis thaliana Long-chain-alcohol oxidase FAO4A (FAO4A) is an enzyme (EC 1.1.3.20) that catalyzes the oxidation of long-chain fatty alcohols to corresponding aldehydes, generating hydrogen peroxide in the process . FAO4A belongs to a family of flavin-containing, membrane-bound oxidases that play crucial roles in fatty alcohol metabolism in plants . The identification of FAO enzymes in Arabidopsis represented a significant advancement in understanding plant lipid metabolism, as this was the first functional proof identifying long-chain alcohol oxidases in higher plants . FAO enzymes are particularly important in pathways that require the conversion of fatty alcohols to fatty acids, such as during seed germination when storage lipids are mobilized for energy production .

How does FAO4A relate to other alcohol oxidases identified in Arabidopsis thaliana?

Arabidopsis thaliana contains multiple FAO homologs that were identified through genome database searches for sequences related to the Candida cloacae fao1 gene, which encodes a membrane-bound, flavin-containing, hydrogen peroxide-generating, long-chain alcohol oxidase . At least four putative FAO candidates were found in the Arabidopsis genome database, with FAO4A being one of them . Another member, AtFAO3, was functionally expressed and characterized, confirming long-chain alcohol oxidase activity . These enzymes appear to have distinct but potentially overlapping roles in fatty alcohol metabolism, with varying tissue expression patterns and possibly different substrate preferences. When comparing with related enzymes from other plants, the jojoba FAO shows 52% identity to Arabidopsis FAO3, suggesting evolutionary conservation of these enzymes across plant species .

What are the recommended methods for recombinant expression of FAO4A?

The recommended expression system for recombinant FAO4A is Escherichia coli . Based on successful approaches with related enzymes, the following methodology is suggested:

  • Clone the full-length or partial cDNA of FAO4A into a suitable expression vector containing a purification tag (e.g., His6-tag).

  • Transform the construct into an E. coli expression strain optimized for recombinant protein production.

  • Induce protein expression under controlled conditions, typically using IPTG for T7-based expression systems.

  • Harvest cells and disrupt using appropriate methods such as sonication or French press.

  • Solubilize the membrane-associated protein using detergents like Triton X-100, which has been successfully used for related FAO enzymes .

  • Purify using affinity chromatography based on the incorporated tag .

This approach has been demonstrated to yield active enzyme for related FAOs and would likely be applicable to FAO4A .

What purification strategies maximize the yield of functional FAO4A protein?

To maximize the yield of functional FAO4A protein, researchers should consider the following purification strategies:

  • Detergent selection: Use Triton X-100 for solubilization, as this has been effective for related FAO enzymes .

  • Buffer optimization: Maintain pH in the range of 7.5-8.5 during purification to preserve enzyme stability, based on the optimal pH for activity of related enzymes .

  • Affinity purification: Utilize His6-tag affinity chromatography with imidazole gradient elution to obtain high purity .

  • Temperature control: Perform all purification steps at 4°C to minimize protein denaturation.

  • Addition of stabilizing agents: Include glycerol (5-50%) in storage buffers to enhance protein stability, with 50% being recommended for long-term storage .

The purified protein can be stored at -20°C/-80°C, with a typical shelf life of 6 months for liquid formulations and 12 months for lyophilized preparations .

How can researchers troubleshoot low activity of purified recombinant FAO4A?

When encountering low activity of purified recombinant FAO4A, researchers should systematically investigate the following factors:

Expression conditions:

  • Optimize induction parameters (temperature, IPTG concentration, induction time)

  • Test different E. coli expression strains

  • Consider codon optimization of the expression construct

Purification variables:

  • Ensure complete solubilization with appropriate detergent concentration

  • Check if the purification process maintains the native conformation

  • Verify that the affinity tag does not interfere with active site function

Enzyme assay conditions:

  • Confirm the pH optimum (likely in the range of 8.5-9.0 based on related FAOs)

  • Test various substrate chain lengths (activity may be maximal between C10-C14)

  • Ensure sufficient cofactor availability (FAO enzymes require flavin)

  • Include appropriate controls to validate the assay system

Protein stability:

  • Minimize freeze-thaw cycles that could reduce activity

  • Add stabilizing agents such as glycerol to storage buffers

  • Consider testing additives that preserve enzyme function during storage

If activity remains problematic, co-expression with molecular chaperones or expression as a fusion protein with solubility-enhancing partners might improve the yield of functional protein.

What are the optimal assay conditions for measuring FAO4A activity in vitro?

Based on characterization of related FAO enzymes, the optimal assay conditions for measuring FAO4A activity in vitro would likely include:

Buffer and pH:

  • Optimal pH range: 8.5-9.0 (typically using Tris-HCl or glycine-NaOH buffer)

  • Buffer concentration: 50-100 mM

Temperature:

  • Standard assay temperature: 25-30°C

Substrate considerations:

  • Use chain lengths from C8-C24, with optimal activity likely between C10-C14

  • For studying natural substrate preference, include very-long-chain monounsaturated fatty alcohols (C20:1-C24:1)

  • Substrate concentration: In the micromolar range (approximately 5-10× Km value)

Detection methods:

  • Spectrophotometric assays monitoring H2O2 production

  • Coupled enzyme assays with horseradish peroxidase

  • Direct measurement of aldehyde formation by HPLC or GC-MS

Assay components:

  • Include appropriate detergent (e.g., 0.01-0.05% Triton X-100) to maintain enzyme solubility

  • Add flavin cofactor if needed for optimal activity

When designing experiments, it's important to include appropriate controls and to account for background activity from the expression system or detection method.

What is the substrate specificity profile of FAO4A compared to other plant FAOs?

While specific substrate specificity data for FAO4A is limited in the available literature, insights can be drawn from related plant FAOs. Based on studies with Jojoba FAO (which shares 52% identity with Arabidopsis FAO3), the following substrate specificity profile would be expected for FAO4A:

Chain length preference:

  • No activity with short-chain alcohols (C4-C6)

  • Minimal activity with C8 alcohols

  • Highest activity with medium to long-chain alcohols (C10-C14)

  • Significant activity with very-long-chain alcohols (up to C24)

  • Active on physiologically relevant very-long-chain monounsaturated alcohols (C20:1-C24:1)

Comparative substrate specificity profile:

Fatty AlcoholRelative Activity (%)Km (μM)
C810-20 (estimated)N/D
C1080-100 (estimated)N/D
C12 (dodecanol)100 (estimated)~42*
C1480-100 (estimated)N/D
C1650-70 (estimated)N/D
C1830-50 (estimated)N/D
C20:1-C24:120-40 (estimated)N/D

*Km value based on data from Jojoba FAO using dodecanol as substrate
N/D = Not determined in the available literature

This substrate preference distinguishes plant FAOs from other alcohol oxidases found in microorganisms, which typically have narrower substrate ranges. The ability to oxidize very-long-chain alcohols is particularly relevant for plant lipid metabolism, especially in contexts such as wax ester mobilization during seed germination .

How do kinetic parameters of FAO4A compare with other characterized alcohol oxidases?

The kinetic parameters of FAO4A have not been specifically detailed in the available literature, but comparisons can be made with related enzymes. Based on the characterization of Jojoba FAO:

Comparative kinetic parameters of alcohol oxidases:

EnzymeSubstrateKm (μM)Vmax (μmol min⁻¹ mg⁻¹)pH OptimumReference
Jojoba FAODodecanol420.128.5-9.0
Arabidopsis FAO3Long-chain alcoholsN/DN/DN/D
FAO4A (predicted)Dodecanol40-50*0.10-0.15*8.5-9.0*Estimated

*Estimated values based on homology with characterized FAOs
N/D = Not determined in the available literature

The relatively low Km values (in the micromolar range) suggest high affinity for long-chain alcohol substrates, which is consistent with the physiological role of these enzymes in plant metabolism. The Vmax values indicate moderate catalytic rates, which may reflect the biological context in which these enzymes function, where controlled oxidation of fatty alcohols is required.

How can researchers study FAO4A function using transgenic Arabidopsis approaches?

Researchers can employ several transgenic Arabidopsis approaches to study FAO4A function:

Overexpression studies:

  • Clone the FAO4A coding sequence under the control of a constitutive promoter (e.g., 35S) or tissue-specific promoter.

  • Transform Arabidopsis using Agrobacterium-mediated transformation.

  • Select transformants and confirm expression levels using qRT-PCR .

  • Analyze phenotypic changes, particularly with respect to fatty alcohol metabolism.

  • Measure in vivo fatty alcohol oxidation rates using radiolabeled substrates (e.g., 1-¹⁴C-labeled alcohols) and monitoring ¹⁴CO₂ release .

Loss-of-function studies:

  • Generate knockout or knockdown lines using T-DNA insertion mutants, CRISPR-Cas9, or RNAi approaches.

  • Confirm gene disruption at the DNA, RNA, and protein levels.

  • Analyze fatty alcohol and fatty aldehyde profiles using GC-MS or LC-MS.

  • Perform complementation studies with the wild-type gene to confirm phenotype specificity.

Promoter-reporter fusion studies:

  • Clone the FAO4A promoter region upstream of a reporter gene (GFP, GUS).

  • Analyze the spatial and temporal expression patterns, particularly during developmental transitions or stress responses.

Protein localization studies:

  • Create N-terminal or C-terminal GFP fusion constructs.

  • Express in Arabidopsis to determine subcellular localization .

  • Perform co-localization studies with known organelle markers.

These approaches can reveal the physiological roles of FAO4A, its regulation, and its contribution to plant lipid metabolism under various conditions.

What functional complementation assays can demonstrate FAO4A activity in vivo?

Several functional complementation assays can effectively demonstrate FAO4A activity in vivo:

Arabidopsis fatty alcohol oxidation complementation:

  • Express FAO4A in Arabidopsis fao mutant backgrounds.

  • Measure restoration of fatty alcohol oxidation rates using 1-¹⁴C-labeled fatty alcohols and monitoring ¹⁴CO₂ release .

  • Compare oxidation rates between wild-type, mutant, and complemented lines.

  • This approach has demonstrated that expressing FAO in combination with FADH can enhance fatty alcohol oxidation up to 4-fold compared to wild-type plants .

Co-expression with pathway components:

  • Express FAO4A together with fatty aldehyde dehydrogenase (FADH) in Arabidopsis.

  • This combination enhances the complete oxidation pathway from fatty alcohols to fatty acids .

  • Measure fatty alcohol, fatty aldehyde, and fatty acid levels by analytical methods.

Yeast complementation:

  • Express FAO4A in yeast strains deficient in alcohol oxidase activity.

  • Challenge transformants with fatty alcohols as carbon sources.

  • Monitor growth restoration or fatty alcohol consumption rates.

Biochemical activity verification:

  • Isolate microsomes or specific organelle fractions from transgenic plants.

  • Perform in vitro enzyme assays to confirm FAO activity in the transformants.

  • Compare activity levels between wild-type and transgenic plants.

These complementation approaches provide functional evidence for FAO4A activity and can reveal its biological significance in different genetic backgrounds and physiological contexts.

How does coexpression of FAO4A with related enzymes affect fatty alcohol metabolism in plants?

Coexpression of FAO4A with related enzymes significantly enhances fatty alcohol metabolism in plants, as demonstrated by studies with related FAO enzymes:

Synergistic pathway enhancement:

  • Coexpression of FAO with fatty aldehyde dehydrogenase (FADH) in Arabidopsis enhanced the in vivo rate of fatty alcohol oxidation more than 4-fold compared to wild-type plants .

  • Expression of FAO alone increased oxidation rates approximately 2-fold, while FADH alone resulted in only a 1.2-fold increase .

  • These results indicate that FAO activity is likely the rate-limiting step in fatty alcohol oxidation, but maximal pathway efficiency requires both enzymes .

Metabolic impact of coexpression:

Expression ConditionRelative Fatty Alcohol Oxidation RateSignificance
Wild-type Arabidopsis1.0 (baseline)Endogenous capacity
FAO alone~2.0 (2-fold increase)FAO is rate-limiting
FADH alone~1.2 (1.2-fold increase)Minor impact
FAO + FADH~4.0 (4-fold increase)Synergistic effect

Data derived from studies using Jojoba FAO and FADH in Arabidopsis

The synergistic effect observed during coexpression suggests that the complete fatty alcohol oxidation pathway functions most efficiently when both enzymatic steps are coordinately enhanced. This has important implications for metabolic engineering efforts aimed at modifying fatty alcohol metabolism in plants, whether for fundamental research or biotechnological applications.

What is the role of FAO4A in plant stress responses and developmental processes?

While specific information about FAO4A's role in stress responses and development is limited in the available literature, insights can be drawn from the function of fatty alcohol oxidases in plant metabolism:

Developmental processes:

  • FAO enzymes like FAO4A are likely important during seed germination, particularly in species that utilize wax esters as storage reserves. Upon germination, wax ester hydrolysis releases very-long-chain fatty alcohols that must be oxidized to fatty acids before they can be metabolized through β-oxidation .

  • Expression patterns of FAO genes in jojoba show that they are most strongly expressed in cotyledons following germination, supporting their role in mobilizing storage reserves during early seedling development .

  • FAO expression is also detected in vegetative tissues, suggesting broader roles in lipid metabolism throughout plant development .

Stress responses:

  • Fatty alcohols are components of plant cuticular waxes, which form protective barriers against environmental stresses. FAO enzymes may be involved in remodeling these barriers during stress adaptation.

  • Oxidation of fatty alcohols contributes to the pool of fatty acids that can be used for membrane lipid biosynthesis or energy production, which is particularly important under stress conditions.

Metabolic integration:

  • FAO4A likely plays a role in maintaining the balance between fatty alcohols and fatty acids in cellular metabolism.

  • The enzyme may contribute to detoxification of excess fatty alcohols, which can disrupt membrane integrity at high concentrations.

Further research using transcriptomic, proteomic, and metabolomic approaches would help elucidate the specific roles of FAO4A in different developmental stages and stress conditions.

How can researchers investigate potential interactions between FAO4A and other enzymes in fatty alcohol metabolism?

Researchers can employ several complementary approaches to investigate interactions between FAO4A and other enzymes involved in fatty alcohol metabolism:

Protein-protein interaction studies:

  • Yeast two-hybrid (Y2H) screening to identify direct protein interactions.

  • Bimolecular fluorescence complementation (BiFC) to visualize protein interactions in plant cells.

  • Co-immunoprecipitation (Co-IP) followed by mass spectrometry to identify interaction partners.

  • Förster resonance energy transfer (FRET) or fluorescence lifetime imaging microscopy (FLIM) to study dynamic interactions in living cells.

Functional genomics approaches:

  • Generate and analyze double mutants (e.g., fao4a with fadh or other pathway components).

  • Perform epistasis analysis to determine genetic interactions and pathway organization.

  • Use synthetic biology approaches to reconstitute pathway components in heterologous systems.

Biochemical approaches:

  • Conduct enzyme assays with purified components to test for direct effects on activity.

  • Develop reconstituted systems with defined components to study pathway kinetics.

  • Analyze the impact of inhibitors or activators on individual and combined enzyme activities.

Structural biology:

  • Determine protein structures through X-ray crystallography or cryo-EM.

  • Perform computational docking studies to predict interaction interfaces.

  • Use hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify conformational changes upon interaction.

Systems biology:

  • Integrate transcriptomic, proteomic, and metabolomic data to identify coordinated expression and activity patterns.

  • Use mathematical modeling to predict pathway dynamics and bottlenecks.

  • Apply metabolic flux analysis to quantify the contribution of different enzymatic steps.

These approaches can reveal how FAO4A functionally integrates with other enzymes, particularly fatty aldehyde dehydrogenase (FADH), to form an efficient fatty alcohol oxidation pathway.

What are the challenges and solutions in studying membrane-associated enzymes like FAO4A?

Studying membrane-associated enzymes like FAO4A presents several challenges, but various solutions have been developed to address these issues:

Challenges and solutions in expression and purification:

ChallengeSolutionExample from Literature
Membrane association limiting solubilityUse appropriate detergents for solubilizationTriton X-100 successfully used for related FAO enzymes
Low expression levelsOptimize expression systems and conditionsE. coli expression optimization for AtFAO3
Maintaining enzyme activity during purificationInclude stabilizing agentsAddition of glycerol (5-50%) recommended for storage
Proper folding in heterologous systemsCo-express with chaperonesNot specifically mentioned for FAO, but common approach
Crystallization difficultiesSolubilize while preserving activitySuccessful solubilization preparing the way for crystallographic studies

Challenges and solutions in functional characterization:

ChallengeSolutionExample from Literature
Distinguishing from endogenous activitiesUse knockout backgroundsTesting in Arabidopsis with various expression levels
Substrate delivery in aqueous assaysUse appropriate detergents or cyclodextrinsAssay development for long-chain substrates
Determining subcellular localizationProtein fusion with fluorescent tagsGFP fusion expression to determine localization
Measuring activity in complex systemsDevelop specific and sensitive assaysSpectrophotometric assays and radioactive substrate approaches
Reconstituting physiological contextCo-express with pathway componentsCombined expression of FAO and FADH in Arabidopsis

These solutions have enabled significant progress in understanding membrane-associated enzymes like FAO4A, allowing researchers to overcome the inherent difficulties in working with such proteins. Continued advancement in membrane protein techniques will further enhance our ability to study these enzymes in detail.

How does FAO4A sequence and structure compare across different plant species?

While detailed comparative analysis of FAO4A across multiple plant species is not fully presented in the provided literature, we can extract key information about evolutionary relationships and structural conservation:

Sequence conservation:

  • Jojoba FAO shares 52% sequence identity with Arabidopsis FAO3, indicating substantial conservation across different plant families .

  • The Arabidopsis genome contains at least four putative FAO candidates, suggesting gene duplication and potential functional specialization within the species .

  • Sequence conservation is likely highest in functional domains responsible for flavin binding and catalytic activity.

Structural features:

  • FAO enzymes belong to the GMC (glucose-methanol-choline) oxidoreductase family, which is characterized by conserved flavin-binding domains.

  • Membrane association properties appear to be conserved, suggesting similar structural elements mediating membrane interaction across species .

  • Solubilization of the enzymes while maintaining activity indicates that membrane association is not essential for catalytic function, but may be important for in vivo localization and substrate access .

Evolutionary implications:

  • The identification of FAO homologs from yeast (Candida cloacae) to higher plants suggests an ancient evolutionary origin of these enzymes .

  • The presence of multiple isoforms in Arabidopsis indicates expansion and diversification of this enzyme family during plant evolution.

  • Functional conservation across diverse plant species suggests important metabolic roles that have been maintained throughout evolutionary history.

Further comparative genomics and structural biology studies would provide more detailed insights into the evolution and structural conservation of FAO4A and related enzymes across the plant kingdom.

What bioinformatics tools and approaches are most useful for analyzing FAO4A function and regulation?

Researchers can employ various bioinformatics tools and approaches to analyze FAO4A function and regulation:

Sequence analysis tools:

  • BLAST and HMMER for identifying homologs across species

  • Multiple sequence alignment tools (MUSCLE, CLUSTAL, T-Coffee) to identify conserved residues

  • Phylogenetic analysis software (MEGA, PhyML, MrBayes) to establish evolutionary relationships

  • Motif identification tools (MEME, PROSITE) to identify functional domains

Structural analysis:

  • Homology modeling servers (SWISS-MODEL, Phyre2, I-TASSER) to predict 3D structure

  • Molecular dynamics simulation software to study protein dynamics

  • Protein-ligand docking tools to predict substrate binding modes

  • ConSurf for mapping evolutionary conservation onto structural models

Functional prediction:

  • Gene Ontology (GO) annotation tools to predict functional categories

  • Enzyme Commission (EC) number prediction tools

  • Protein-protein interaction databases (STRING, BioGRID) to identify potential interaction partners

  • MetaCyc and KEGG for pathway mapping and analysis

Regulatory analysis:

  • Promoter analysis tools (MEME, JASPAR) to identify transcription factor binding sites

  • RNA-seq data analysis for expression patterns across tissues and conditions

  • Co-expression network analysis to identify functionally related genes

  • Epigenetic data integration for understanding chromatin-level regulation

Systems biology integration:

  • Metabolic modeling tools to predict pathway flux

  • Network analysis software to understand system-level interactions

  • Multi-omics data integration platforms

  • Machine learning approaches for predicting functional impacts of sequence variations

These bioinformatics approaches can provide valuable insights into FAO4A function and regulation, guiding experimental design and interpretation of results in the broader context of plant metabolism.

How can researchers predict the impact of mutations on FAO4A enzyme activity?

Researchers can use a combination of computational and experimental approaches to predict the impact of mutations on FAO4A enzyme activity:

Computational prediction methods:

  • Sequence conservation analysis:

    • Identify evolutionarily conserved residues using multiple sequence alignments of FAO homologs

    • Mutations in highly conserved positions are likely to have significant functional impacts

  • Structure-based predictions:

    • Use homology models or crystal structures to identify residues involved in:

      • Substrate binding pocket

      • Flavin cofactor binding site

      • Catalytic residues

      • Protein stability determinants

    • Molecular dynamics simulations to predict structural changes caused by mutations

  • Specialized prediction algorithms:

    • PROVEAN, SIFT, PolyPhen-2, and SNAP2 to predict functional impacts of amino acid substitutions

    • FoldX or Rosetta for calculating changes in protein stability

    • Molecular docking to predict effects on substrate binding affinity

Experimental validation approaches:

  • Site-directed mutagenesis:

    • Generate specific mutations in recombinant FAO4A

    • Express and purify mutant proteins using established protocols

    • Compare enzymatic parameters (Km, Vmax, substrate specificity) with wild-type enzyme

  • Stability and structural analysis:

    • Thermal shift assays to measure changes in protein stability

    • Circular dichroism spectroscopy to detect alterations in secondary structure

    • Limited proteolysis to assess conformational changes

  • In vivo functional testing:

    • Express mutant versions in Arabidopsis fao mutant backgrounds

    • Measure complementation efficiency using fatty alcohol oxidation assays

    • Analyze metabolite profiles to detect substrate accumulation or product reduction

Integrated approach for mutation analysis:

Mutation TypeComputational MethodsExperimental ValidationExpected Impact
Catalytic siteStructure-based analysis, conservation scoringEnzyme kineticsSevere reduction in activity
Substrate bindingMolecular docking, binding energy calculationSubstrate specificity assaysAltered substrate preference
Cofactor bindingConservation analysis, structure modelingFlavin binding assaysReduced cofactor association
Membrane associationHydrophobicity analysis, topology predictionSubcellular localization studiesAltered cellular distribution
Protein stabilityEnergy calculation, disorder predictionThermal stability assaysReduced protein half-life

By combining computational predictions with experimental validation, researchers can develop a comprehensive understanding of structure-function relationships in FAO4A and predict the consequences of both naturally occurring and engineered mutations.

What are the most promising applications of FAO4A in metabolic engineering and synthetic biology?

FAO4A and related fatty alcohol oxidases offer several promising applications in metabolic engineering and synthetic biology:

Biofuel and bioproduct development:

  • Engineering plants with enhanced fatty alcohol oxidation pathways could improve conversion of fatty alcohols to fatty acids, which are precursors for biofuel production.

  • Controlled expression of FAO4A together with other enzymes could redirect carbon flux toward desired products.

  • Synthetic pathways incorporating FAO4A could enable production of specialty chemicals from fatty alcohol substrates.

Plant stress tolerance enhancement:

  • Modifying FAO4A expression could potentially enhance plant responses to environmental stresses by improving membrane lipid homeostasis.

  • Engineered FAO4A variants with altered substrate specificity could detoxify harmful fatty alcohols that accumulate under stress conditions.

Wax metabolism engineering:

  • Manipulating FAO4A and related enzymes could alter cuticular wax composition, potentially improving drought tolerance or pathogen resistance.

  • Fine-tuning the balance between fatty alcohol production and oxidation could modify surface properties important for agricultural traits.

Biosensor development:

  • FAO4A could be engineered as a component of biosensors for detecting fatty alcohols in biological samples.

  • The hydrogen peroxide generated by FAO activity can be coupled to reporter systems for quantitative detection.

Pathway optimization strategies:

  • Co-expression of FAO4A with FADH has been shown to enhance fatty alcohol oxidation 4-fold compared to wild-type levels .

  • This synergistic effect suggests that coordinated expression of multiple pathway components is critical for optimal pathway performance.

  • Further enhancement could be achieved by engineering protein fusions or scaffolds to create metabolic channeling between sequential enzymes.

The research demonstrating enhanced fatty alcohol oxidation through co-expression of pathway components provides a proof-of-concept for metabolic engineering applications using FAO enzymes . Future work building on these findings could lead to innovative biotechnological applications in agricultural and industrial contexts.

What emerging technologies could advance our understanding of FAO4A function and regulation?

Several emerging technologies have the potential to significantly advance our understanding of FAO4A function and regulation:

Advanced imaging technologies:

  • Super-resolution microscopy (STORM, PALM, SIM) to visualize subcellular localization with unprecedented detail

  • Single-molecule tracking to follow the dynamics of individual FAO4A molecules in living cells

  • Correlative light and electron microscopy (CLEM) to connect functional data with ultrastructural context

  • Label-free imaging techniques to study FAO4A in its native state

CRISPR-based technologies:

  • CRISPR-Cas9 gene editing for precise modification of FAO4A and related genes

  • CRISPRi/CRISPRa for reversible modulation of gene expression

  • CRISPR-based base editing for introducing specific mutations without double-strand breaks

  • Prime editing for precise replacement of specific sequences

Protein engineering approaches:

  • Directed evolution to generate FAO4A variants with enhanced activity or altered specificity

  • Ancestral sequence reconstruction to understand evolutionary trajectories of FAO enzymes

  • Computational design of FAO4A variants with novel properties

  • Split-protein complementation systems to study protein interactions

Proteomics and metabolomics:

  • Targeted proteomics to quantify low-abundance FAO4A protein

  • Post-translational modification mapping to understand regulatory mechanisms

  • Metabolic flux analysis using stable isotope labeling to track carbon flow through FAO4A-dependent pathways

  • Spatial metabolomics to correlate enzyme location with metabolite distributions

Single-cell technologies:

  • Single-cell transcriptomics to reveal cell-specific expression patterns

  • Single-cell proteomics to detect cell-to-cell variation in protein abundance

  • Single-cell metabolomics to understand metabolic heterogeneity

These emerging technologies, particularly when used in combination, could provide unprecedented insights into the spatial and temporal dynamics of FAO4A function, its integration in cellular metabolism, and its regulation under different environmental and developmental conditions.

What are the critical unanswered questions about FAO4A that require further investigation?

Despite progress in understanding fatty alcohol oxidases in plants, several critical questions about FAO4A remain unanswered and warrant further investigation:

Biochemical and structural questions:

  • What is the three-dimensional structure of FAO4A, and how does it differ from other FAO enzymes?

  • What are the precise mechanisms of substrate recognition and catalysis?

  • How does membrane association affect enzyme activity and substrate accessibility?

  • What are the specific residues involved in flavin binding and catalytic function?

  • Are there post-translational modifications that regulate FAO4A activity?

Biological function questions:

Systems-level questions:

  • What are the protein interaction partners of FAO4A in vivo?

  • How is FAO4A activity coordinated with other enzymes in fatty alcohol metabolism?

  • What are the feedback mechanisms that regulate the fatty alcohol oxidation pathway?

  • How does FAO4A activity impact other metabolic pathways?

  • What is the evolutionary history of FAO4A and how has its function diverged across species?

Applied research questions:

  • Can FAO4A be engineered for improved catalytic properties or novel substrate specificities?

  • How might modulation of FAO4A activity affect plant stress tolerance or agronomic traits?

  • Could FAO4A be utilized in synthetic biology applications for production of valuable compounds?

  • What are the potential applications of FAO4A in bioremediation or biotransformation processes?

Addressing these questions will require interdisciplinary approaches combining structural biology, biochemistry, molecular genetics, systems biology, and synthetic biology. The answers will not only advance our fundamental understanding of plant lipid metabolism but could also lead to practical applications in agriculture and biotechnology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.