Recombinant Arabidopsis thaliana Long-chain-alcohol oxidase FAO4B (FAO4B)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Arabidopsis thaliana Long-chain-alcohol oxidase FAO4B (FAO4B)

Recombinant Arabidopsis thaliana Long-chain-alcohol oxidase FAO4B (FAO4B) is an enzyme that belongs to the fatty alcohol oxidase (FAO) family, specifically isolated from the plant Arabidopsis thaliana . Fatty alcohol oxidases, in general, are involved in the oxidation of long-chain fatty alcohols . These enzymes play a crucial role in various metabolic pathways, particularly in the biosynthesis of cuticular waxes in plants .

Role in Cuticular Wax Biosynthesis

  • Wax Composition Cuticular waxes are essential for plant survival, providing a protective layer on the plant surface that prevents water loss and protects against environmental stresses . These waxes are composed of a complex mixture of lipids, including alkanes, alcohols, aldehydes, and fatty acids .

  • Pathway Interaction FAO4B plays a significant role in linking the alcohol- and alkane-forming pathways in wax biosynthesis. It functions to suppress the accumulation of primary alcohols while contributing to the production of aldehydes, a crucial step in alkane synthesis .

  • Functional Redundancy FAO4B exhibits functional redundancy with other FAOs, such as FAO3. Studies have shown that the absence of FAO4B results in decreased amounts of waxes from the alkane-forming pathway, with even more significant reductions observed in fao3 fao4b double mutants .

Research Findings and Functional Studies

  • Gene Overexpression Studies Overexpression of FAO4B in Arabidopsis leads to a dramatic reduction in primary alcohols and a significant increase in aldehydes and related waxes. This confirms the enzyme's role in converting alcohols to aldehydes .

  • Yeast Complementation Assays Expressing FAO4B in yeast strains co-expressing CER4 and FAR1 (enzymes involved in alcohol synthesis) results in decreased amounts of C18-C26 alcohols, further supporting its function in reducing alcohol accumulation .

  • In vitro Characterization Recombinant FAO4B has been expressed in Escherichia coli to study its biochemical properties. These studies have provided insights into its substrate specificity, pH optima, and other kinetic parameters .

Potential Applications

  • Engineering Plant Traits Understanding the role of FAO4B in wax biosynthesis opens up possibilities for engineering plants with altered wax profiles. This could enhance their tolerance to drought, pests, and other environmental stresses .

  • Industrial Applications Modifying wax composition through FAO4B manipulation could also have industrial applications, such as producing waxes with specific properties for coatings, cosmetics, and other products .

Data Tables

PropertyDescription
Gene NameFAO4B
Enzyme ClassFatty Alcohol Oxidase
Subcellular LocalizationEndoplasmic Reticulum (ER)
SubstrateLong-chain fatty alcohols
ProductAldehydes
RoleSuppresses accumulation of primary alcohols, contributes to aldehyde production in cuticular wax biosynthesis
Functional RedundancyExhibits redundancy with FAO3
Effect of OverexpressionDramatic reduction of primary alcohols, significant increase of aldehydes and related waxes
Effect of MutationDecreased amounts of waxes from the alkane-forming pathway; more significant reductions in fao3 fao4b double mutants
Potential ApplicationsEngineering plants with altered wax profiles for enhanced stress tolerance; producing waxes with specific properties for industrial applications (e.g., coatings, cosmetics, etc.)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
FAO4B; At4g28570; T5F17.20; Long-chain-alcohol oxidase FAO4B; Long-chain fatty alcohol oxidase 4B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-748
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
FAO4B
Target Protein Sequence
MEDVRRRNRGHPLLRSKKRGEGYNHGFSPSQIQSLAVICQTFLPPETTSEQQAVNSFHVA SSTQPPFTDEVAEMIVKNGRSEAVKVLRIILMILSFRFGTLLLCGSLCLDKSWPFVLKFS QLPLDKREAILRNWSRQSGFLLPFRITFFLAKFYTLFYFFSQTDENLKNPALEAIGYCID GTERSSNKKSEADEKRRPLEKGIIETMHESDVTITQSLTEKGVHVARDDGDNVYRIRCDA VVVGSGSGGGVAAANLAKAGLKVLVLEKGNYFTAHDYSGLEVPSMLELYEKGGLLTTVDG KFMLLAGSAVGGGTAVNWSASIRTPDHVLQEWSEGSKIKFFGSQEYQSAMDEVTIRIGVT ERCVKHGFQNQVLRKGCERLGLQVESVPRNSPEDHYCGLCGYGCRAGAKNGTDQTWLVDA VENGAVILTGIKAERFVLVDNTSSSNERKKRCVGVFASSVGGKIGKKFIIEARVTVSSAG SLLTPPLMLSSGLKNPNIGRNLKLHPVLMTWGYFPEKDSEFSGKMYEGGIITSVHHMNDT ESGCKAILENPLIGPASYAGLSPWVSGPDLKERMIKYGRTAHLFALVRDLGSGEVMMENE VTYRTTKKDRENLRAGLRQALRVSVAAGAVEVGTYRSDGQKMKCEAITKEAMEEFLDEVD AVGGVGTKGEYWTTYFSAHQMGSCRMGVTAEEGALDENGESWEAEGLFVCDGSILPSAVG VNPMITIQSTAYCISSKIVDSLQNKTKV
Uniprot No.

Target Background

Function
Recombinant *Arabidopsis thaliana* Long-chain-alcohol oxidase FAO4B (FAO4B) is a long-chain fatty alcohol oxidase involved in the ω-oxidation pathway of lipid degradation.
Database Links

KEGG: ath:AT4G28570

STRING: 3702.AT4G28570.1

UniGene: At.25986

Protein Families
GMC oxidoreductase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is FAO4B and where is it found in Arabidopsis thaliana?

FAO4B (Fatty Alcohol Oxidase 4B) is a protein involved in cuticular wax biosynthesis in Arabidopsis thaliana. It is highly expressed in the distal stems of the plant and is localized to the endoplasmic reticulum. FAO4B works together with FAO3 to connect the alcohol- and alkane-forming pathways in stem wax biosynthesis, playing a critical role in plant cuticle formation .

What is the molecular structure of FAO4B?

FAO4B is a full-length protein consisting of 748 amino acids. For research purposes, recombinant versions can be produced with tags such as His-tag, typically in E. coli expression systems. The protein's localization to the endoplasmic reticulum suggests it contains transmembrane domains or signal sequences that facilitate its integration into this cellular compartment .

What is the primary biochemical function of FAO4B in plant metabolism?

FAO4B primarily functions as a fatty alcohol oxidase that converts primary alcohols to aldehydes in the cuticular wax biosynthesis pathway. This conversion is a critical step linking the alcohol-forming and alkane-forming pathways. FAO4B's enzymatic activity effectively reduces the accumulation of primary alcohols while promoting the formation of aldehydes, which can subsequently be converted to alkanes and other wax components .

How do FAO3 and FAO4B connect the alcohol- and alkane-forming pathways?

FAO3 and FAO4B serve as the "missing link" between the alcohol- and alkane-forming pathways in cuticular wax biosynthesis. These enzymes oxidize primary alcohols (products of the alcohol-forming pathway) to aldehydes, which are then utilized by the alkane-forming pathway. Studies have shown that mutation of CER4, a key gene in the alcohol-forming pathway, leads to deficiency in the alkane-forming pathway in distal stems, suggesting interconnection between these pathways. FAO3 and FAO4b provide this connection by converting the accumulated alcohols to aldehydes, which can then enter the alkane-forming pathway .

What phenotypic changes occur when FAO4B is overexpressed or mutated?

Overexpression of FAO4B in Arabidopsis results in a dramatic reduction of primary alcohols and significant increases in aldehydes and related wax components. Conversely, mutations in the fao4b gene lead to decreased amounts of waxes derived from the alkane-forming pathway. The double mutant fao3 fao4b exhibits even more severe reductions in these wax components, confirming the functional redundancy between these two proteins and their importance in wax biosynthesis .

What expression systems are effective for producing recombinant FAO4B?

E. coli has been successfully used to produce recombinant FAO4B protein with His-tags for research purposes. The full-length protein (1-748 amino acids) can be expressed and purified using this system. Additionally, yeast expression systems, particularly Saccharomyces cerevisiae strain INVSC1, have been employed for functional studies of FAO4B. For yeast expression, the FAO4B coding sequence can be introduced into vectors such as pESC-Ura downstream of the GAL1 promoter using restriction enzymes like SalI and KpnI .

How can researchers study FAO4B expression patterns?

To study FAO4B expression patterns, researchers commonly use promoter-GUS reporter gene fusion constructs. This approach involves cloning approximately 2 kb of the upstream fragment of FAO4B from Arabidopsis genomic DNA and introducing it into vectors such as pMDC162 using appropriate restriction enzymes (e.g., KpnI and AscI). After Agrobacterium-mediated transformation into Arabidopsis Col-0, T3 generation lines can be used for β-glucuronidase (GUS) histochemical analysis to visualize the spatial and temporal expression patterns of FAO4B .

What yeast systems can be used for functional characterization of FAO4B?

Yeast expression systems, particularly Saccharomyces cerevisiae strain INVSC1 (MATa his3-D1 leu2 trp1-289 ura3-52), are valuable for functional characterization of FAO4B. The FAO4B coding sequence can be cloned into vectors like pESC-Ura downstream of the GAL1 promoter. For co-expression studies with interacting proteins, constructs like pESC-CER4/FAR1 have been used. Transformants are selected on minimal medium lacking appropriate amino acids, and expression is typically induced by galactose. This system allows researchers to investigate FAO4B's enzymatic activities and interactions with other proteins involved in wax biosynthesis .

How can RNA-seq be used to analyze FAO4B-regulated genes?

RNA-seq analysis is a powerful approach to identify genes regulated by FAO4B. Researchers can design experiments comparing gene expression profiles between wild-type plants, fao4b mutants, and FAO4B overexpression lines. In studies examining related systems, RNA-seq samples are typically collected at specific time points (e.g., 18 and 24 hours post-inoculation), and tissues are pooled from multiple plants with the same treatment. RNA extraction can be performed using commercial kits like the Qiagen RNeasy Plant Mini Kit. Sequencing libraries can be prepared and sequenced on platforms such as NovaSeq 6000. Raw reads should be trimmed for adaptor sequences and low-quality bases using tools like Trimmomatic, then aligned to the reference genome using aligners like STAR. Differential gene expression analysis can be performed using tools such as DESeq2, with appropriate FDR cutoffs (typically 5-10%) .

How can deep learning approaches be applied to predict FAO4B-regulated genes?

Deep learning approaches can be used to predict genes potentially regulated by FAO4B. This methodology can be implemented by collecting large transcriptomic datasets (e.g., from the NCBI SRA database) representing diverse tissues and treatments. The data should be processed by trimming adaptor sequences and removing low-quality bases, then aligning to the reference genome. Positive training datasets can be constructed using verified regulatory gene pairs from model organisms, while negative datasets can be generated by randomly pairing genes without known regulatory relationships. Convolutional Neural Network (CNN) models can then be trained using these datasets, with approximately 10% of the data reserved for validation. This approach allows researchers to predict potential regulatory relationships involving FAO4B and identify candidate genes for experimental validation .

What techniques can reveal the interactions between FAO4B and other proteins in the wax biosynthesis pathway?

To study interactions between FAO4B and other proteins in the wax biosynthesis pathway, researchers can employ yeast co-expression systems. For example, FAO4B can be co-expressed with proteins like CER4 and FAR1 in yeast to examine their functional relationships. The experimental results showed that expressing FAO3 or FAO4b led to significantly decreased amounts of C18-C26 alcohols in yeast co-expressing CER4 and FAR1, providing evidence for functional interactions between these proteins. Other approaches that could be applied include yeast two-hybrid assays, co-immunoprecipitation, and bimolecular fluorescence complementation to directly visualize protein-protein interactions in planta .

How should researchers interpret the functional redundancy between FAO3 and FAO4B?

When interpreting data related to FAO3 and FAO4B functional redundancy, researchers should consider several key points. First, analyze phenotypes of both single and double mutants (fao3, fao4b, and fao3 fao4b) to assess the degree of redundancy. Research has shown that while single mutation in fao4b resulted in decreased wax components from the alkane-forming pathway, the fao3 fao4b double mutant exhibited significantly more severe reductions, indicating partial redundancy. Second, compare expression patterns of both genes, as they may have overlapping but distinct expression domains. Finally, consider that functional redundancy may be context-dependent, varying across different tissues or developmental stages. Complementation experiments, where one gene is expressed in the background of a double mutant, can help determine the extent to which each gene can compensate for the loss of the other .

What are the key considerations when analyzing metabolic flux through alcohol- and alkane-forming pathways?

When analyzing metabolic flux through alcohol- and alkane-forming pathways involving FAO4B, researchers should consider several factors. First, quantify multiple wax components simultaneously (primary alcohols, aldehydes, alkanes, and related compounds) to obtain a comprehensive view of pathway dynamics. Second, consider the temporal aspect of wax biosynthesis, as the relative contributions of different pathways may change during development. Third, account for potential feedback mechanisms where accumulation of certain intermediates may affect enzyme activities or gene expression. Fourth, examine how environmental factors (drought, temperature, light) may affect the balance between pathways. Finally, integrate transcriptomic data with metabolite profiling to correlate changes in gene expression with alterations in wax composition. The interconnection between alcohol- and alkane-forming pathways demonstrated by FAO3 and FAO4B highlights the importance of system-level approaches rather than focusing on isolated pathway segments .

What are promising approaches for manipulating FAO4B to enhance plant stress tolerance?

Given FAO4B's role in cuticular wax biosynthesis, which is crucial for plant water retention and stress protection, several approaches could be explored to enhance plant stress tolerance. Controlled overexpression of FAO4B, possibly using tissue-specific or stress-inducible promoters, could increase aldehyde and alkane content in the cuticle, potentially enhancing water-proofing and stress resistance. CRISPR-Cas9 gene editing could be used to modify FAO4B regulatory regions to optimize its expression under stress conditions. Additionally, researchers might explore engineering FAO4B protein variants with enhanced activity or stability. Before implementing these strategies, comprehensive phenotyping should assess not only stress tolerance but also potential trade-offs in growth, development, and reproduction. The functional redundancy between FAO3 and FAO4B suggests that combinatorial approaches targeting both genes might be necessary for maximal effect .

How might high-throughput phenotyping improve our understanding of FAO4B function?

High-throughput phenotyping technologies could significantly advance our understanding of FAO4B function in plant biology. Hyperspectral imaging could non-destructively monitor changes in cuticular properties across developmental stages and under various environmental conditions in FAO4B mutants or overexpression lines. Automated morphological phenotyping platforms could capture subtle growth and developmental phenotypes resulting from altered FAO4B activity. Mass spectrometry imaging techniques could provide spatially resolved information about wax component distribution across plant surfaces. Thermal imaging could assess water retention capabilities linked to FAO4B-mediated changes in cuticle composition. Integration of these diverse phenotypic datasets with transcriptomic and metabolomic data using machine learning approaches could reveal previously unrecognized functions of FAO4B and its broader impact on plant physiology beyond cuticular wax biosynthesis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.