Recombinant Arabidopsis thaliana Magnesium transporter MRS2-10 (MRS2-10)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Information

The AtMRS2-10 gene, also referred to as AtMGT1, is located on chromosome 1 in Arabidopsis thaliana with the locus identifier At1g80900 . The protein is associated with the plasma membrane of root cells and is known for its magnesium ion transport capabilities .

Key identifiers for AtMRS2-10:

  • KEGG: ath:AT1G80900

  • STRING: 3702.AT1G80900.1

  • UniGene: At.33869

Experimental Studies and Functional Analysis

AtMRS2-10 has been functionally expressed in E. coli TM2 cells, showing that these cells can grow in a medium supplemented with magnesium . The growth of TM2 cells expressing AtMRS2-10 was inhibited by aluminum, suggesting a role in both magnesium and aluminum transport .

Magnesium Uptake: Studies using Saccharomyces cerevisiae have shown that AtMRS2-10 complements yeast mrs2 mutants, confirming its role in magnesium uptake .

Expression Patterns: Tissue-specific expression patterns have been observed for the MRS2/MGT family members, with six members being expressed in root tissues, suggesting their involvement in magnesium supply and distribution in plants .

Mutant Analysis

Experiments using knockout mutants of AtMRS2-10 (mrs2-10) have provided insights into its function.

  • Knockout lines of mrs2-10 did not show significant differences in leaf magnesium levels compared to wild-type plants under standard nutrient conditions, which makes its role as a primary magnesium uptake transporter uncertain .

  • mrs2-10 knockout lines do not mitigate the growth-inhibiting effects of high magnesium sulfate concentrations, indicating that the phytotoxic effects are dominated by the magnesium cation .

Role in Magnesium Homeostasis

AtMRS2-10 plays a role in magnesium homeostasis within the plant. Overexpression of AtMRS2-10 in Nicotiana benthamiana led to increased accumulation of magnesium, manganese, and iron .

Availability of Recombinant Protein

Recombinant Arabidopsis thaliana Magnesium transporter MRS2-10 is available for research purposes from commercial sources in various forms :

  • Source: E. coli, Yeast, Mammalian cells, and Baculovirus

  • Tag: Avi-tag Biotinylated E. coli biotin ligase (BirA)

Researchers can inquire about the size and specific details from suppliers .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment based on availability.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MRS2-10; MGT1; At1g80900; F23A5.26; Magnesium transporter MRS2-10; Magnesium Transporter 1; AtMGT1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-443
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
MRS2-10
Target Protein Sequence
MSELKERLLPPRPASAINLRGDAGSRPSPSGRQPLLGVDVLGLKKRGQGLKSWIRVDTSA NSQVIEVDKFTMMRRCDLPARDLRLLDPLFVYPSTILGREKAIVVNLEQIRCIITADEVL LLNSLDNYVLRYVVELQQRLKASSVTEVWNQDSLELSRRRSRSLDNVLQNSSPDYLPFEF RALEVALEAACTFLDSQASELEIEAYPLLDELTSKISTLNLERARRLKSRLVALTRRVQK VRDEIEQLMDDDGDMAEMYLTEKKKRMEGSLYGDQSLPVYRTNDCFSLSAPVSPVSSPPE SRRLEKSLSIVRSRHDSARSSEDATENIEELEMLLEAYFVVIDSTLNKLTSLKEYIDDTE DFINIQLDNVRNQLIQFELLLTTATFVVAIFGVVAGIFGMNFEIDFFEKPGAFKWVLAIT GVCGLVVFLAFLWYYKRRRLMPL
Uniprot No.

Target Background

Function

High-affinity magnesium transporter mediating magnesium influx and contributing to aluminum tolerance.

Gene References Into Functions
  1. Schläpfer, U., et al. (2012). Functional reconstitution and characterization of the Arabidopsis Mg(2+) transporter AtMRS2-10 in proteoliposomes. Plant Physiology, 159(3), 1164-1175. PMID: 22560897
Database Links

KEGG: ath:AT1G80900

STRING: 3702.AT1G80900.1

UniGene: At.33869

Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35.5) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the whole plant.

Q&A

What is the structural basis for MRS2-10's transport function?

MRS2-10 possesses the characteristic GMN tripeptide motif (Glycine-Methionine-Asparagine) at the end of the first of two C-terminal transmembrane domains. This motif is highly conserved across the CorA superfamily and is critical for Mg²⁺ transport function . While no crystal structure has been reported specifically for plant MRS2-10, insights from the human MRS2 homolog (which forms a homo-pentameric complex) suggest that MRS2-10 likely forms a similar oligomeric channel structure. In human MRS2, residues R332 and M336 serve as major gating residues, controlling magnesium ion flux through the channel. A network of hydrogen bonds connects these gating residues to the soluble domain, potentially providing a regulatory mechanism . By analogy, similar structural features likely regulate Arabidopsis MRS2-10 activity, though plant-specific variations may exist.

Where is MRS2-10 expressed in Arabidopsis thaliana?

MRS2-10 displays a highly cell type-specific expression pattern that differs markedly from other members of the MRS2/MGT family. Promoter-GUS fusion studies have revealed that MRS2-10 is predominantly expressed in:

  • Hydathodes of the cotyledons during early development

  • The epicotyl region

  • Trichomes (specialized leaf hair cells)

Unlike some other family members that show broad expression patterns or vascular-specific localization, MRS2-10's expression is highly localized to specific cell types . This specialized expression pattern suggests MRS2-10 may have tissue-specific functions distinct from other family members, potentially related to secretory processes in hydathodes or specialized magnesium homeostasis in trichomes.

What ion transport capabilities does MRS2-10 possess?

MRS2-10 primarily functions as a magnesium (Mg²⁺) transporter, but displays interesting ion selectivity properties. Direct measurements using the fluorescent dye mag-fura-2 in reconstituted proteoliposomes have revealed that MRS2-10:

  • Mediates rapid Mg²⁺ uptake as its primary function

  • Exhibits substantial Ni²⁺ transport activity

  • Shows almost no Co²⁺ transport activity

  • Can transport aluminum (Al) ions, as demonstrated by morin fluorescence assays

  • Has its Mg²⁺ transport activity inhibited by aluminum

This multifunctional transport capability distinguishes MRS2-10 from some other family members, such as MRS2-1, which shows Mg²⁺ transport activity but is impermeable to aluminum and its Mg²⁺ transport is not inhibited by Al .

How does aluminum affect MRS2-10 function and what are the physiological implications?

Aluminum significantly impacts MRS2-10 function through multiple mechanisms:

Direct Inhibition of Transport Activity:

  • Rapid Mg²⁺ uptake through MRS2-10 is substantially inhibited by aluminum

  • Al likely competes with Mg²⁺ for binding sites within the channel pore

Aluminum Transport:

  • MRS2-10 can itself transport aluminum ions, as demonstrated by assays using the Al-sensitive dye morin

  • This Al transport capability is not shared by all MRS2 family members (e.g., MRS2-1 is impermeable to Al)

Cellular Toxicity in Heterologous Systems:

  • In E. coli expression systems, cells expressing MRS2-10 show increased aluminum sensitivity compared to those expressing MRS2-1

  • This suggests that MRS2-10 transports Al into cells, where it can inhibit cellular growth and metabolism

The physiological implications of this Al sensitivity are significant for plants growing in acidic soils, where Al toxicity is a major concern. MRS2-10's dual capability to transport Al and have its Mg²⁺ transport inhibited by Al may represent an important mechanism by which Al toxicity manifests in plants. This also suggests that differential expression or regulation of various MRS2 family members (some Al-sensitive, others Al-insensitive) could contribute to aluminum tolerance mechanisms in plants.

How does MRS2-10 differ functionally from other members of the MRS2/MGT family?

MRS2-10 displays several distinctive functional properties compared to other family members:

PropertyMRS2-10MRS2-1MRS2-7Other Members
Mg²⁺ Transport EfficiencyHighHighHighVariable
Al TransportYesNoNot determinedVariable
Al Inhibition of Mg²⁺ TransportStrongNoneNot determinedVariable
Expression PatternHydathodes, trichomesVascular tissueRoot-specificTissue-dependent
Subcellular LocalizationNot specified in dataTonoplastNot specifiedVariable
Functional ComplementationComplements yeast mrs2ΔComplements yeast mrs2ΔComplements yeast mrs2ΔAll complement
Phenotype of Single KnockoutNo significant phenotypeNo significant phenotypeStrong Mg²⁺-dependent phenotypeVariable

These differences suggest functional specialization within the MRS2/MGT family, with MRS2-10 potentially playing roles in specialized cell types where its unique transport properties (including Al transport) may be physiologically relevant .

What is known about the regulatory mechanisms controlling MRS2-10 expression and activity?

Regulation of MRS2-10 appears to occur at multiple levels:

Transcriptional Regulation:

  • MRS2-10 shows highly cell-type specific expression patterns (hydathodes, trichomes)

  • Interestingly, there is no evidence for magnesium-dependent regulation of MRS2-10 gene expression

  • RT-PCR analyses of plants grown at different Mg²⁺ concentrations (50, 500, or 1500 μM) showed no significant changes in transcript levels

Post-Translational Regulation:
While not specifically documented for MRS2-10, insights from homologous proteins suggest potential regulatory mechanisms:

  • Structural data from human MRS2 reveals a network of hydrogen bonds connecting gating residues to the soluble domain, suggesting allosteric regulation

  • Mg²⁺ binding in the soluble domain may regulate channel opening/closing

  • The presence of two Mg²⁺-binding sites in the soluble domain of human MRS2 suggests potential for feedback regulation

The lack of transcriptional response to varying Mg²⁺ concentrations suggests that post-translational regulatory mechanisms may be particularly important for controlling MRS2-10 activity in response to changing cellular magnesium status.

What are the phenotypic consequences of MRS2-10 mutation or knockout in plants?

Interestingly, despite its specialized expression pattern and unique transport properties, single-gene knockout mutants of MRS2-10 do not display significant phenotypic abnormalities under standard growth conditions . This suggests functional redundancy within the MRS2/MGT family. Specific findings include:

  • Single knockout mutants of MRS2-10 show no obvious growth or developmental defects

  • Even double knockout lines (mrs2-5 mrs2-10) display no impairment in plant growth and development

  • This redundancy persists despite strong and specialized expression patterns

  • Knockout of MRS2-7 (which is exclusively expressed in roots) produces a strong magnesium-dependent phenotype when plants are grown under low Mg²⁺ conditions (50 μM)

The lack of phenotype in MRS2-10 knockouts might be explained by:

  • Functional redundancy with other transporters

  • The specialized nature of cells expressing MRS2-10 (hydathodes, trichomes) which may not be essential under laboratory conditions

  • Potential phenotypes that might only manifest under specific environmental stresses not tested in available studies

What expression systems are effective for producing recombinant MRS2-10 for functional studies?

Several expression systems have proven effective for functional studies of MRS2-10:

Escherichia coli:

  • The E. coli strain TM2 (deficient in Mg²⁺ transport) has been successfully used for functional complementation assays with MRS2-10

  • This system allows assessment of MRS2-10's ability to transport Mg²⁺ in a cellular context

  • Additionally, it permits evaluation of aluminum sensitivity, as E. coli cells expressing MRS2-10 show increased Al sensitivity

Saccharomyces cerevisiae:

  • The yeast mrs2Δ mutant (deficient in mitochondrial Mg²⁺ uptake) can be complemented by MRS2-10

  • This system allows assessment of growth on non-fermentable carbon sources (e.g., glycerol) which require functional mitochondria

  • MRS2-10 shows good complementation efficiency, though not as high as the native yeast Mrs2p

Reconstituted Proteoliposomes:

  • MRS2-10 has been successfully reconstituted into proteoliposomes

  • This cell-free system allows direct biochemical characterization of transport properties

  • It permits precise control of ion concentrations and inhibitors

  • Enables direct measurement of transport kinetics using fluorescent indicators

Each system offers distinct advantages for different research questions, with proteoliposomes providing the most direct assessment of transport properties, while cellular systems allow evaluation of physiological function and toxic effects.

What techniques can be used to measure MRS2-10-mediated magnesium transport?

Several complementary techniques have been successfully employed to measure MRS2-10-mediated magnesium transport:

Mag-fura-2 Fluorescence Assays:

  • Mag-fura-2 is a UV-excitable, Mg²⁺-dependent fluorescent indicator

  • It undergoes a blue shift from 380 to 340 nm upon Mg²⁺ binding

  • Can be used with isolated mitochondria or reconstituted proteoliposomes

  • Allows real-time measurements of Mg²⁺ flux

  • Permits quantification of initial transport rates and response to inhibitors

Functional Complementation of Yeast mrs2Δ Mutant:

  • Growth on non-fermentable carbon sources (e.g., YPdG medium with glycerol)

  • Assessment of mitochondrial function as an indirect measure of Mg²⁺ transport

  • Allows comparison of relative transport efficiencies between different MRS2 proteins

  • Growth can be monitored over extended periods (hours to days)

Complementation of E. coli Strain TM2:

  • Growth assays under Mg²⁺-limited conditions

  • Assessment of Mg²⁺ transport based on rescue of growth defects

  • Can be combined with aluminum exposure to test inhibition

Morin Fluorescence Assays:

  • Morin is an Al-sensitive fluorescent dye

  • Can be used to assess aluminum transport through MRS2-10

  • Complements mag-fura-2 assays to provide a more complete picture of ion selectivity

For comprehensive characterization, a combination of these techniques is recommended, as each provides different insights into transport kinetics, selectivity, and regulation.

How can researcher effectively study the interaction between aluminum and MRS2-10?

Studying the complex interaction between aluminum and MRS2-10 requires multiple experimental approaches:

Transport Inhibition Studies:

  • Mag-fura-2 fluorescence assays with MRS2-10-containing proteoliposomes

  • Addition of aluminum at various concentrations during Mg²⁺ uptake measurements

  • Quantification of IC₅₀ (half-maximal inhibitory concentration) for aluminum

  • Assessment of inhibition kinetics (competitive vs. non-competitive)

Direct Aluminum Transport Measurements:

  • Morin fluorescence assays to directly measure aluminum uptake

  • Reconstitution of MRS2-10 in proteoliposomes loaded with the Al-sensitive dye morin

  • Addition of external aluminum and measurement of fluorescence changes

  • Control experiments with non-functional MRS2-10 mutants to confirm channel-mediated transport

Cellular Toxicity Assays:

  • Expression of MRS2-10 in E. coli

  • Growth measurements in media containing various aluminum concentrations

  • Comparison with cells expressing other MRS2 family members (e.g., MRS2-1)

  • Assessment of aluminum accumulation in cells

Structure-Function Studies:

  • Site-directed mutagenesis of MRS2-10 to identify residues involved in aluminum binding/inhibition

  • Focus on the conserved GMN motif and neighboring residues

  • Testing of mutants using the above functional assays

  • Comparison with aluminum-insensitive family members (e.g., MRS2-1) to identify key differences

These complementary approaches can provide a comprehensive picture of how aluminum interacts with MRS2-10, including mechanisms of inhibition, direct transport, and structural determinants of aluminum sensitivity.

What strategies are available for generating and characterizing MRS2-10 knockout and overexpression lines?

Knockout Generation:

  • T-DNA insertion lines are available through repositories such as the Arabidopsis Biological Resource Center

  • CRISPR-Cas9 genome editing can create precise deletions or mutations

  • Confirmation of knockout status requires:

    • PCR genotyping to confirm insertion/mutation

    • RT-PCR analysis to verify absence of transcript

    • Western blotting if antibodies are available

Overexpression Strategies:

  • CaMV 35S promoter-driven expression constructs have been successfully used for MRS2 genes

  • Tissue-specific promoters may be valuable for targeted expression

  • Gateway cloning system facilitates rapid generation of various expression constructs

  • Agrobacterium-mediated transformation of Arabidopsis is the standard delivery method

Phenotypic Characterization:

  • Growth under varying magnesium concentrations (50, 500, 1500 μM)

  • Assessment of biomass accumulation under different Mg²⁺ conditions

  • Analysis of tissue-specific magnesium content

  • Examination of specialized structures where MRS2-10 is expressed (hydathodes, trichomes)

  • Challenge with aluminum stress to assess tolerance/sensitivity

  • Double or triple knockout combinations to address functional redundancy

Expression Analysis:

  • Quantitative RT-PCR to measure transcript levels

  • Promoter-GUS fusions to visualize tissue-specific expression patterns

  • For overexpression lines, verification of increased transcript and protein levels

  • Assessment of potential compensatory changes in expression of other MRS2 family members

By combining these approaches, researchers can comprehensively evaluate the physiological roles of MRS2-10 in planta and potentially identify conditions where its function becomes critical despite the apparent redundancy observed under standard growth conditions.

What are the key unresolved questions about MRS2-10 structure and function?

Despite significant advances in understanding MRS2-10, several important questions remain unresolved:

  • Structural Determination: What is the atomic structure of MRS2-10, and how does it compare to bacterial CorA and human MRS2? X-ray crystallography or cryo-EM studies could reveal plant-specific features of the transport mechanism.

  • Subcellular Localization: While the tissue-specific expression of MRS2-10 is known, its precise subcellular localization remains unclear. Is it plasma membrane-localized, or does it function in organellar membranes?

  • Physiological Role of Aluminum Transport: What is the ecological significance of MRS2-10's ability to transport aluminum? Does this represent a detoxification mechanism or an unintended vulnerability?

  • Regulation Mechanisms: How is MRS2-10 activity regulated post-translationally? Are there specific protein-protein interactions or post-translational modifications that modulate its function?

  • Functional Redundancy: Given the lack of phenotype in single knockouts, what is the precise contribution of MRS2-10 to plant magnesium homeostasis? Under what conditions might its function become essential?

Addressing these questions will require integrative approaches combining structural biology, cell biology, biochemistry, and whole-plant physiology.

How can heterologous expression systems be optimized for biochemical and structural studies of MRS2-10?

For researchers seeking to conduct detailed biochemical or structural studies of MRS2-10, several optimization strategies should be considered:

Expression Optimization:

  • Codon optimization for the host organism (E. coli, yeast, or insect cells)

  • Use of strong inducible promoters with tight regulation

  • Fusion tags that enhance protein solubility (MBP, SUMO, etc.)

  • Low-temperature induction to improve proper folding

  • Co-expression with molecular chaperones if aggregation occurs

Purification Strategies:

  • Affinity tags (His₆, Strep-tag II, FLAG) for initial capture

  • Size exclusion chromatography to isolate properly assembled pentamers

  • Inclusion of magnesium throughout purification to maintain stability

  • Careful detergent selection for membrane extraction (DDM, LMNG recommended)

  • On-column detergent exchange for reconstitution studies

Functional Verification:

  • Reconstitution into proteoliposomes for transport assays

  • Thermostability assays to optimize buffer conditions

  • Circular dichroism to confirm proper secondary structure

  • Limited proteolysis to identify stable domains

Structural Studies Preparation:

  • Screening multiple orthologs from different plant species

  • Creating chimeric constructs with structurally characterized homologs

  • Systematic truncation of disordered regions

  • Nanobody or antibody fragment co-crystallization to stabilize conformations

These optimizations can significantly increase the likelihood of obtaining sufficient quantities of properly folded, functional protein for detailed biochemical characterization and structural determination.

What is the current consensus on the physiological importance of MRS2-10 in plant magnesium homeostasis?

Based on the available research data, the following consensus has emerged regarding MRS2-10's role in plant magnesium homeostasis:

  • MRS2-10 functions as a bona fide magnesium transporter with high transport efficiency as demonstrated by direct mag-fura-2 uptake measurements and complementation studies .

  • Its specialized expression pattern (hydathodes, trichomes, epicotyl) suggests a tissue-specific role rather than a global contribution to whole-plant magnesium uptake .

  • The lack of significant phenotypes in knockout lines indicates functional redundancy within the MRS2/MGT family under standard growth conditions, though specific environmental challenges might reveal unique functions .

  • MRS2-10's ability to transport aluminum and its sensitivity to aluminum inhibition may represent an important connection between magnesium homeostasis and aluminum toxicity in plants .

  • Unlike some transporters, MRS2-10 expression is not regulated by external magnesium availability, suggesting constitutive expression in its specific cell types regardless of magnesium status .

This consensus underscores the complexity of magnesium transport systems in plants, with specialized transporters like MRS2-10 likely playing important roles in specific contexts or under particular environmental conditions that have not yet been fully explored experimentally.

How does research on MRS2-10 contribute to our broader understanding of plant mineral nutrition?

Research on MRS2-10 has made several important contributions to our understanding of plant mineral nutrition:

  • Ion Transport Selectivity: Studies of MRS2-10 have revealed unexpected transport capabilities beyond magnesium, including aluminum transport. This highlights how transporters can influence multiple mineral pathways simultaneously .

  • Specialized Cell Functions: The highly localized expression pattern of MRS2-10 emphasizes the importance of cell-specific mineral transport systems, particularly in specialized structures like hydathodes and trichomes .

  • Functional Redundancy: The lack of phenotype in MRS2-10 knockouts illustrates the robust nature of plant mineral homeostasis, with multiple transporters ensuring essential functions are maintained .

  • Aluminum-Magnesium Interactions: MRS2-10's dual role in magnesium transport and aluminum sensitivity provides a molecular mechanism for understanding how aluminum toxicity might disrupt magnesium nutrition in plants .

  • Evolutionary Conservation: The functional complementation of yeast mrs2 mutants by plant MRS2-10 demonstrates the deep evolutionary conservation of magnesium transport mechanisms across eukaryotes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.