Recombinant Arabidopsis thaliana Magnesium transporter MRS2-11, chloroplastic (MRS2-11)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MRS2-11; GMN10; MGT10; At5g22830; MRN17.6; Magnesium transporter MRS2-11, chloroplastic; Magnesium Transporter 10; AtMGT10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
63-459
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
MRS2-11
Target Protein Sequence
CFAKSPTTAEDFVGDYESLNVSDDDDGSDSNSSDGDNGGGRDDSKKIDSSSSSSSSDSTS LGIREPVYEVVEVKATGAISTRKINRRQLLKSSGLRPRDIRSVDPSLFMTNSVPSLLVRE HAILLNLGSLRAIAMRDRVLIFDYNRRGGRAFVDTLMPRLNPRSMNGGPSMPFELEAVES ALISRIQRLEQRLMDIEPRVQALLEVLPNRLTADILEELRISKQRLVELGSRAGALRQML LDLLEDPHEIRRICIMGRNCTLRRGDDDLECTLPSDKLIAEEEEEEIEMLLENYLQRCES CHGQAERLLDSAKEMEDSIAVNLSSRRLEVSRFELLLQVGTFCVAVGALIAGIFGMNLRS YLEEQASAFWLTTGGIIIGAAVAFFLMYSYLSRRKIF
Uniprot No.

Target Background

Function
High-affinity magnesium transporter mediating magnesium influx into chloroplasts.
Gene References Into Functions
  1. Studies demonstrate that the growth of TM2 expressing AtMRS2-10 and AtMRS2-11 reflects their Mg2+ and aluminum transport functions. PMID: 25772503
Database Links

KEGG: ath:AT5G22830

STRING: 3702.AT5G22830.1

UniGene: At.49049

Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35.5) family
Subcellular Location
Plastid, chloroplast membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the green part of the plant. Preferentially expressed in the spongy mesophyll cells and stomata of young leaves but also detected in cotyledons and at the base of the leaf petioles.

Q&A

How can researchers validate the Mg²⁺ transport activity of recombinant MRS2-11?

Methodological approaches:

  • Heterologous expression in yeast mutants: Complementation assays using Saccharomyces cerevisiae mrs2 mutants (defective in mitochondrial Mg²⁺ uptake) to restore growth on nonfermentable substrates (e.g., YPdG) .

  • Proteoliposome assays: Reconstituting purified MRS2-11 into liposomes and measuring Mg²⁺ uptake using fluorescent dyes like mag-fura-2 .

  • Electrophysiological recordings: Using patch-clamp techniques to detect Mg²⁺ currents in lipid bilayers or mammalian cell membranes .

Key considerations:

ParameterRecommendationSource
Host systemE. coli TM2 strain for functional screening; yeast for mitochondrial localization
Mg²⁺ concentrationUse 1–50 mM Mg²⁺ in assays to avoid aluminum interference
ControlsInclude empty vector or non-functional mutants (e.g., ΔGly-Met-Asn motif)

What subcellular localization strategies are effective for studying MRS2-11?

Advanced techniques:

  • GFP tagging: Fuse MRS2-11 to GFP for live-cell imaging in Arabidopsis protoplasts or heterologous systems (e.g., Expi293F cells). Confirm chloroplast envelope localization via colocalization with stromal markers .

  • Biochemical fractionation: Isolate chloroplast membranes and perform immunoblotting with anti-MRS2-11 antibodies to validate envelope integration .

Data interpretation challenges:

  • False positives: ER- or mitochondrial localization may occur due to improper targeting signals. Use mitochondrial transit peptide (MTP) truncations (e.g., Δ1–70) to confirm chloroplast-specific sorting .

How to design complementation assays for MRS2-11 in yeast or E. coli mutants?

Protocol optimization:

  • Yeast mrs2 mutants: Transform with MRS2-11 fused to yeast mitochondrial targeting sequences (e.g., Mrs2p MTP). Test growth on YPdG .

  • E. coli TM2 strain: Express MRS2-11 in ΔcorA mutants to restore Mg²⁺ uptake. Inhibit growth with Al³⁺ (2 mM) to confirm Mg²⁺-specific transport .

Critical controls:

ControlPurpose
Vector-onlyExclude plasmid-induced toxicity
Wild-type CorACompare transport efficiency
MRS2-11 mutants (ΔGMN motif)Validate Mg²⁺-specific activity

What purification challenges exist for recombinant MRS2-11, and how to address them?

Common issues:

  • Low solubility: MRS2-11’s transmembrane domains may aggregate in E. coli. Use detergents like DDM or CHAPS during purification .

  • Incomplete MTP cleavage: Full-length MRS2-11 may mislocalize. Confirm cleavage via N-terminal sequencing (e.g., cleavage at residue 71 in human MRS2) .

Optimized workflow:

  • Expression: E. coli BL21(DE3) with His-tagged MRS2-11 (residues 63–459) .

  • Purification: Ni-NTA affinity chromatography followed by size-exclusion chromatography (SEC) .

  • Validation: SDS-PAGE to confirm purity (>90%) and Western blotting with anti-His antibodies .

How to resolve discrepancies in MRS2-11’s functional roles across studies?

Contradiction analysis:

  • Phenotype variability: Single mrs2-11 knockouts show no phenotype under normal Mg²⁺, but mrs2-7 mutants exhibit Mg deficiency under low Mg²⁺ . Reason: Redundancy among MRS2/MGT family members (e.g., MRS2-1, MRS2-5) .

  • Localization conflicts: Some studies report chloroplast localization, while others suggest mitochondrial roles. Resolution: Use organelle-specific markers (e.g., chloroplast stromal HSP21) to confirm targeting .

Experimental design:

ParameterVariableExpected Outcome
Mg²⁺ concentration0.5 mM vs. 1 mMReveal stress-dependent MRS2-11 activity
Tissue typeLeaves vs. rootsIdentify tissue-specific redundancy

What are the key considerations for heterologous expression of MRS2-11?

Host system selection:

HostAdvantagesLimitations
E. coliHigh yield, easy purificationPoor eukaryotic post-translational modifications
YeastMitochondrial targetingLimited Mg²⁺ uptake assays
Mammalian cellsNative folding, functional assaysLow yield, complex protocols

Expression optimization:

  • C-terminal truncations: Remove cytosolic domains to improve membrane integration (e.g., MRS2-11(71–443)) .

  • Co-expression with chaperones: Use mitochondrial Hsp70 to aid folding in E. coli .

How to study MRS2-11’s regulatory mechanisms under varying Mg²⁺ conditions?

Advanced approaches:

  • Al³³⁺ inhibition assays: Measure Mg²⁺ uptake in proteoliposomes exposed to Al³³⁺ (2 mM). MRS2-11 may transport Al³³⁺, affecting Mg²⁺ selectivity .

  • Ca²⁺ competition: Test Mg²⁺ uptake in the presence of Ca²⁺ (0.8 mM) to probe cation interactions .

Data interpretation:

  • Negative feedback: Mg²⁺ binding to N-terminal domains may inhibit oligomerization, reducing transport activity .

  • Salt bridge disruption: Mutating R116/E291 residues in soluble domains increases channel activity .

What are the implications of MRS2-11’s role in chloroplast development for plant physiology?

Research applications:

  • Breeders: Engineer Mg-efficient crops by overexpressing MRS2-11 in chloroplasts .

  • Stress biology: Study mrs2-11 mutants under combined Mg deficiency and light stress to model chloroplast dysfunction .

Key findings:

PhenotypeConditionMechanism
ChlorosisLow Mg²⁺Impaired Mg²⁺ uptake → stunted chloroplast development
Photosynthetic declineHigh lightMg²⁺ depletion disrupts ATP synthesis

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.