Recombinant Arabidopsis thaliana Magnesium transporter MRS2-1 (MRS2-1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MRS2-1; MGT2; At1g16010; T24D18.11; Magnesium transporter MRS2-1; Magnesium Transporter 2; AtMGT2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-442
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
MRS2-1
Target Protein Sequence
MSELKERLLPPRPASAMNLRDASVTRPSASGRPPLLGVDVLGLKKRGQGLRSWIRVDTSG NTQVMEVDKFTMMRRCDLPARDLRLLDPLFVYPSTILGREKAIVVNLEQIRCIITADEVL LLNSLDNYVLRYVVELQQRLKTSSVGEMWQQENSQLSRRRSRSFDNAFENSSPDYLPFEF RALEIALEAACTFLDSQASELEIEAYPLLDELTSKISTLNLERVRRLKSRLVALTRRVQK VRDEIEQLMDDDGDMAEMYLTEKKRRMEGSMYGDQSLLGYRSNDGLSVSAPVSPVSSPPD SRRLDKSLSIARSRHDSARSSEGAENIEELEMLLEAYFVVIDSTLNKLTSLKEYIDDTED FINIQLDNVRNQLIQFELLLTTATFVVAIFGVVAGIFGMNFEIDFFNQPGAFRWVLIITG VCGFVIFSAFVWFFKYRRLMPL
Uniprot No.

Target Background

Function
Magnesium transporter potentially mediating magnesium influx.
Database Links

KEGG: ath:AT1G16010

STRING: 3702.AT1G16010.1

UniGene: At.10367

Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35.5) family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the whole plant except stems.

Q&A

What is the specific function of MRS2-1 in Arabidopsis thaliana?

MRS2-1 (also called MGT2) is a magnesium transporter localized to the tonoplast (vacuolar membrane) in Arabidopsis thaliana. It plays a critical role in magnesium partitioning within mesophyll vacuoles . Research has demonstrated that mesophyll cells accumulate the highest vacuolar concentration of magnesium in Arabidopsis leaves, and MRS2-1 is enriched in these cells . MRS2-1 contributes significantly to magnesium accumulation under serpentine conditions (low calcium environments), and its transcript abundance correlates with magnesium accumulation in these conditions . The protein is particularly important for maintaining proper magnesium homeostasis in leaf tissues, where magnesium serves essential functions in photosynthesis and various enzymatic processes.

What structural features are characteristic of MRS2-1 protein?

The most distinctive structural feature of MRS2-1, like other members of the CorA-MRS2-ALR superfamily, is the presence of the highly conserved GMN (Gly-Met-Asn) tripeptide motif at the end of the first of two C-terminal transmembrane domains . This motif is essential for the protein's function as a magnesium transporter. Research with related transporters has shown that mutations in this motif (such as changing glycine to alanine) severely reduce or abolish magnesium transport activity . The protein contains transmembrane domains that anchor it to the tonoplast membrane, allowing it to facilitate magnesium transport across this membrane barrier . This structural arrangement is critical for its function in compartmentalizing magnesium within the vacuole of mesophyll cells.

How does MRS2-1 complement the yeast mrs2 mutant?

MRS2-1, the founding member of the Arabidopsis gene family, was initially characterized by its ability to complement the yeast mrs2 mutant when targeted to mitochondria . In complementation studies, the MRS2-1 coding sequence is typically fused to the yeast Mrs2p mitochondrial targeting sequence and expressed under the native yeast MRS2 promoter . The complementation is easily monitored by restoration of growth on non-fermentable medium with glycerol as the main carbon source (YPdG), where the yeast mrs2 mutant shows a respiratory deficiency . This complementation ability demonstrates functional conservation between plant and yeast magnesium transporters despite taxonomic distance, and provides a valuable heterologous system for studying MRS2-1 function and structure-function relationships.

What methodologies are most effective for studying MRS2-1 function in planta?

To comprehensively investigate MRS2-1 function in planta, researchers should employ multiple complementary approaches:

  • Genetic approaches: Generate and characterize T-DNA insertion knockout lines for MRS2-1. Compare phenotypes under various magnesium concentrations, particularly under normal and serpentine (low calcium) conditions, as MRS2-1 has been shown to be particularly important under serpentine conditions .

  • Subcellular localization studies: Create fluorescent protein fusions with MRS2-1 to confirm its tonoplast localization using confocal microscopy. This should be validated using multiple approaches, including cell fractionation and Western blotting with organelle-specific markers.

  • Magnesium flux measurements: Utilize X-ray microanalysis for cell-specific vacuolar elemental profiling . This technique has proven effective in determining that mesophyll cells accumulate the highest vacuolar concentration of magnesium in Arabidopsis leaves and that MRS2-1 contributes to this distribution .

  • Complementation assays: Express Arabidopsis MRS2-1 in yeast mrs2 mutants to confirm functional conservation . This approach can also be used to test specific domains or mutations within the protein.

  • Transcriptional analysis: Examine MRS2-1 expression patterns under various magnesium concentrations and in different tissues using qPCR or RNA-seq approaches. This can help correlate expression levels with magnesium accumulation patterns .

How does the GMN motif in MRS2-1 contribute to its magnesium transport activity?

The GMN (Gly-Met-Asn) tripeptide motif in MRS2-1 is critical for its function as a magnesium transporter. Research with the related Mrs2p protein in yeast has provided valuable insights into the importance of this motif:

  • Mutagenesis studies: In yeast Mrs2p, a mutation that exchanges the glycine residue of this motif by an alanine (mrs2-J1, G998→C998) strongly reduces magnesium influx . This suggests that the glycine residue is crucial for transport activity, likely due to its structural properties that may allow proper protein folding or pore formation.

  • Functional consequences: The reduction in magnesium transport caused by mutations in the GMN motif correlates with functional defects. In yeast, the mrs2-J1 mutation impairs group II intron RNA splicing, which depends on proper magnesium concentrations . Similarly, in plants, intact GMN motifs in MRS2 proteins are essential for their magnesium transport functions.

  • Conservation across species: The high conservation of this motif across the CorA-MRS2-ALR superfamily, from bacteria to plants and fungi, indicates its fundamental importance in the mechanism of magnesium transport . This conservation suggests that the basic transport mechanism has been preserved throughout evolution.

These findings collectively indicate that the GMN motif likely forms part of the selectivity filter for magnesium ions and is positioned at a critical location in the transport pore structure.

How does MRS2-1 contribute to magnesium homeostasis under varying environmental conditions?

MRS2-1 plays a dynamic role in magnesium homeostasis that changes with environmental conditions:

  • Response to serpentine conditions: Under serpentine conditions (low calcium environments), MRS2-1 expression is upregulated, and its contribution to mesophyll-specific vacuolar magnesium accumulation becomes particularly important . T-DNA insertion lines for MRS2-1 show perturbed magnesium accumulation under these conditions .

  • Correlation with magnesium availability: MRS2-1 transcript abundance correlates with magnesium accumulation under serpentine conditions, in low calcium-accumulating mutants, and across different Arabidopsis ecotypes with varying leaf magnesium concentrations . This suggests regulatory mechanisms that adjust MRS2-1 expression in response to magnesium availability and plant needs.

  • Role as osmoticum: Research has implicated magnesium as a key osmoticum required to maintain growth in low calcium concentrations in Arabidopsis . MRS2-1's function in vacuolar magnesium sequestration likely contributes to this osmotic regulation, helping plants adapt to challenging soil conditions.

  • Interaction with calcium homeostasis: The particular importance of MRS2-1 under low calcium conditions suggests an interconnection between magnesium and calcium homeostasis systems . MRS2-1 may help balance the intracellular ionic environment when calcium is limited by facilitating magnesium accumulation as an alternative divalent cation.

How do MRS2-1 and other MRS2 family members coordinate magnesium transport across different cellular compartments?

The MRS2/MGT family in Arabidopsis shows a sophisticated division of labor across different subcellular compartments and tissues:

  • Complementary localization patterns: MRS2-1 and MRS2-5 are targeted to the tonoplast and function in mesophyll vacuolar magnesium partitioning . In contrast, MRS2-4 and MRS2-7 localize to the endoplasmic reticulum and contribute to shoot magnesium accumulation . MRS2-11 localizes to the chloroplast envelope membrane and maintains magnesium concentrations in the chloroplast stroma .

  • Tissue-specific expression: MRS2 family members show highly different patterns of tissue-specific expression . Six members (including MRS2-7) are expressed in root tissues, indicating their potential involvement in plant magnesium uptake and distribution after absorption from the soil . MRS2-1 is particularly important in leaf mesophyll cells . MRS2-2, MRS2-3, and MRS2-6 are highly expressed in anthers and are essential for pollen development .

  • Functional redundancy and specialization: Despite some functional overlap, individual MRS2 transporters have evolved specialized roles. For example, the mrs2-7 knockout shows a strong magnesium-dependent phenotype when magnesium concentrations are lowered to 50 μM in hydroponic cultures , demonstrating its specific importance under low-magnesium conditions.

What are the experimental challenges in expressing and purifying recombinant MRS2-1 for structural studies?

Obtaining pure, functional recombinant MRS2-1 for structural studies presents several challenges typical of membrane proteins:

  • Expression system selection: Different expression systems may yield varying results with membrane proteins like MRS2-1. While E. coli is commonly used for recombinant protein production, eukaryotic systems like yeast may provide better results for plant membrane proteins that require specific post-translational modifications or membrane insertion machinery.

  • Protein solubilization: As a membrane protein, MRS2-1 requires careful solubilization with detergents that maintain its native conformation and activity. The choice of detergent is critical, as some may denature the protein or disrupt its functional state.

  • Maintaining functional integrity: Ensuring that purified MRS2-1 retains its magnesium transport activity is essential for meaningful structural studies. This requires careful optimization of purification conditions and functional validation assays.

  • Protein stability: Membrane proteins are often unstable when removed from their native lipid environment. Strategies to enhance stability might include the use of lipid nanodiscs, amphipols, or stabilizing mutations.

  • Crystallization challenges: If X-ray crystallography is the goal, obtaining well-diffracting crystals of membrane proteins is notoriously difficult and may require extensive screening of crystallization conditions and protein constructs.

Researchers typically address these challenges through iterative optimization of expression constructs (including fusion tags, truncations, or chimeric constructs), purification protocols, and stability-enhancing strategies.

What techniques can be used to measure MRS2-1-mediated magnesium transport activity?

Several complementary techniques can be employed to quantify MRS2-1's magnesium transport activity:

  • Mag-fura-2 fluorescence assays: This magnesium-sensitive fluorescent dye has been successfully used to measure magnesium uptake into yeast mitochondria expressing MRS2 proteins . The dye undergoes a spectral shift upon binding to Mg²⁺, allowing real-time monitoring of magnesium influx. This system has been established for measuring magnesium transport by Arabidopsis MRS2 family members in heterologous systems .

  • Complementation assays: The ability of MRS2-1 to rescue growth defects in yeast mrs2 mutants provides a functional readout of magnesium transport activity . The restoration of growth on non-fermentable carbon sources (requiring respiratory function) correlates with the restoration of mitochondrial magnesium uptake .

  • X-ray microanalysis: This technique allows direct measurement of elemental concentrations in specific cell types and subcellular compartments . It has been successfully used to quantify magnesium accumulation in mesophyll vacuoles and correlate it with MRS2-1 function .

  • Electrophysiological approaches: Patch-clamp techniques applied to isolated vacuoles or other membrane systems expressing MRS2-1 can provide direct measurements of magnesium currents and transport kinetics.

  • Radioactive ²⁸Mg²⁺ uptake: Although challenging due to the limited availability of the isotope, this approach provides a direct measure of magnesium transport across membranes.

TechniqueAdvantagesLimitationsApplication to MRS2-1
Mag-fura-2 fluorescenceReal-time measurements; non-radioactivePotential interference from other divalent cationsDemonstrated effective for MRS2 proteins in yeast
Complementation assaysFunctional relevance; simple readoutIndirect measurement; influenced by expression levelsStandard approach for MRS2-1 functional validation
X-ray microanalysisCell-specific; direct elemental quantificationRequires specialized equipment; endpoint measurementProven effective for measuring vacuolar Mg²⁺ in specific cell types
ElectrophysiologyDirect measurement of transport activity; kinetic informationTechnical complexity; challenges with specific membranesPotential for detailed characterization of transport mechanism
Radioactive uptakeDirect measurement of transportLimited isotope availability; safety considerationsLess commonly used but highly specific

How can specificity and selectivity of MRS2-1 for magnesium over other cations be determined?

Determining the ion selectivity profile of MRS2-1 requires methodical approaches:

  • Competition assays: Measure magnesium transport in the presence of increasing concentrations of potential competing cations (Ca²⁺, Mn²⁺, Co²⁺, Ni²⁺, Zn²⁺). A true competitor will reduce magnesium transport in a concentration-dependent manner. This can be assessed using any of the transport assays mentioned previously.

  • Direct transport measurements: Determine if MRS2-1 can transport other divalent cations using ion-specific fluorescent indicators or isotopes. Compare transport rates and affinities (Km values) for different cations.

  • Electrophysiological characterization: Patch-clamp studies can directly measure currents generated by different ions and determine reversal potentials, providing detailed information about selectivity.

  • Mutagenesis studies: Identify amino acid residues involved in ion selectivity by creating point mutations and measuring their effects on transport of different cations. The GMN motif is particularly important for selectivity in this family of transporters .

  • Binding assays: Measure the direct binding of different cations to purified MRS2-1 protein using techniques such as isothermal titration calorimetry or microscale thermophoresis.

What approaches are effective for studying the regulation of MRS2-1 expression and activity in plants?

The regulation of MRS2-1 can be investigated at multiple levels:

  • Transcriptional regulation:

    • Quantitative PCR to measure MRS2-1 transcript levels under different magnesium concentrations, developmental stages, and stress conditions .

    • Promoter-reporter constructs (e.g., MRS2-1 promoter driving GUS or luciferase) to visualize expression patterns in planta.

    • Chromatin immunoprecipitation to identify transcription factors binding to the MRS2-1 promoter.

  • Post-transcriptional regulation:

    • Analysis of alternative splicing patterns using RT-PCR or RNA-Seq. Several MRS2 family members, like MRS2-7, show alternative splicing that affects their function .

    • RNA stability assays to determine if MRS2-1 transcript stability is regulated by magnesium status.

  • Post-translational regulation:

    • Phosphoproteomic analysis to identify potential regulatory phosphorylation sites.

    • Protein stability studies using cycloheximide chase experiments or fusion with destabilized fluorescent proteins.

    • Co-immunoprecipitation to identify interacting proteins that might regulate MRS2-1 activity.

  • Transport activity regulation:

    • Direct measurement of transport activity in isolated vacuoles under different conditions.

    • Analysis of potential oligomerization states, as many transporters are regulated by changes in their quaternary structure.

Research has shown that MRS2-1 transcript abundance correlates with magnesium accumulation under serpentine conditions and varies across different Arabidopsis ecotypes with differing leaf magnesium concentrations . This suggests that transcriptional regulation is an important mechanism controlling MRS2-1 function in response to environmental conditions.

What methods can be used to generate and validate transgenic plants with modified MRS2-1 expression?

Creating and properly validating transgenic plants with altered MRS2-1 expression involves several critical steps:

  • Construct design strategies:

    • Overexpression: Place MRS2-1 coding sequence under a constitutive promoter (35S) or tissue-specific promoter.

    • Knockout: T-DNA insertion lines , CRISPR/Cas9-mediated gene editing, or RNAi constructs.

    • Reporter fusions: N- or C-terminal fusions with fluorescent proteins to study localization and expression patterns.

    • Complementation: Express wild-type MRS2-1 in knockout backgrounds under native or constitutive promoters.

  • Transformation methods:

    • Agrobacterium-mediated floral dip transformation for Arabidopsis.

    • Tissue culture-based methods for crop species with MRS2-1 orthologs.

  • Selection and validation of transgenic lines:

    • Molecular verification: PCR genotyping, Southern blotting to confirm insertion and copy number.

    • Expression analysis: RT-qPCR, Western blotting, or fluorescence microscopy for tagged constructs.

    • Protein localization: Confocal microscopy of fluorescent protein fusions to confirm proper subcellular targeting to the tonoplast .

  • Functional validation:

    • Elemental analysis: ICP-MS or X-ray microanalysis to determine effects on magnesium content and distribution .

    • Phenotypic characterization: Growth measurements under normal and magnesium-limited conditions.

    • Complementation tests: Verify that wild-type MRS2-1 restores normal phenotype in knockout lines.

Studies have successfully employed T-DNA insertion lines to demonstrate MRS2-1's role in mesophyll-specific vacuolar magnesium accumulation under serpentine conditions . When analyzing transgenic plants, it's important to examine multiple independent lines to rule out position effects and to include appropriate controls.

How can researchers effectively investigate the interaction between magnesium transport and calcium signaling involving MRS2-1?

The interaction between magnesium transport via MRS2-1 and calcium signaling can be investigated through:

  • Simultaneous ion measurement:

    • Use dual-fluorescent indicators to monitor both magnesium and calcium concentrations in plant cells simultaneously.

    • Apply calcium channel blockers or calcium chelators and observe effects on MRS2-1-mediated magnesium transport.

    • Manipulate external and internal calcium levels and measure changes in magnesium distribution and MRS2-1 expression.

  • Genetic approaches:

    • Create double mutants combining mrs2-1 mutations with mutations in calcium channels or calcium signaling components.

    • Analyze suppressors or enhancers of mrs2-1 phenotypes to identify calcium-related genes that interact with MRS2-1 function.

  • Calcium signaling readouts:

    • Monitor calcium-dependent gene expression in wild-type versus mrs2-1 mutant plants.

    • Assess activity of calcium-dependent enzymes in different magnesium conditions.

    • Examine calcium oscillation patterns in response to magnesium fluctuations.

  • Physiological responses:

    • Compare stomatal responses (which involve calcium signaling) in wild-type versus mrs2-1 mutants.

    • Analyze root growth responses to combined calcium and magnesium treatments.

Research has demonstrated that MRS2-1 is particularly important under serpentine conditions, which are characterized by low calcium levels . This suggests an interconnection between magnesium homeostasis mediated by MRS2-1 and calcium availability. The finding that magnesium serves as a key osmoticum required to maintain growth in low calcium concentrations further supports this relationship . Understanding this interaction could provide insights into how plants adapt to challenging soil conditions with imbalanced nutrient profiles.

What are promising strategies for improving crop magnesium use efficiency through MRS2-1 engineering?

Enhancing magnesium use efficiency in crops through MRS2-1 engineering presents several promising avenues:

  • Improved expression control:

    • Optimize MRS2-1 expression levels using tissue-specific or stress-responsive promoters rather than constitutive overexpression.

    • Engineer post-transcriptional regulation elements to fine-tune expression in response to magnesium status.

    • Target expression to tissues where magnesium utilization is most critical, such as photosynthetic tissues or developing seeds.

  • Protein engineering approaches:

    • Modify the transport properties of MRS2-1 through targeted mutations to enhance transport capacity or affinity.

    • Adjust subcellular targeting to optimize magnesium distribution between compartments.

    • Create chimeric transporters combining domains from different MRS2 family members to obtain novel properties.

  • Multi-gene strategies:

    • Coordinate the expression of multiple magnesium transporters targeting different cellular compartments.

    • Combine enhanced magnesium transport with improved utilization in key metabolic pathways.

    • Stack MRS2-1 modifications with other nutrient efficiency traits for comprehensive improvement.

  • Species-specific optimization:

    • Identify and modify crop-specific MRS2-1 orthologs based on knowledge gained from Arabidopsis.

    • Adapt strategies to the specific magnesium requirements and utilization patterns of different crop species.

Research has shown that MRS2-1 plays a key role in magnesium partitioning within leaf mesophyll vacuoles . This compartmentation is crucial for maintaining proper cytosolic magnesium levels while storing excess magnesium. Engineering improved vacuolar storage capacity through MRS2-1 modification could potentially allow crops to better buffer against fluctuations in magnesium availability while maintaining optimal growth and photosynthetic efficiency.

How might high-resolution structural studies of MRS2-1 advance our understanding of plant magnesium transport?

Obtaining high-resolution structural information about MRS2-1 would significantly advance the field:

  • Transport mechanism insights:

    • Reveal the precise architecture of the magnesium permeation pathway.

    • Identify key residues involved in magnesium coordination and selectivity.

    • Elucidate the conformational changes associated with transport.

    • Determine the structural basis for the critical role of the GMN motif .

  • Regulatory mechanism understanding:

    • Identify potential regulatory domains or binding sites for interacting proteins.

    • Reveal how post-translational modifications might affect protein structure and function.

    • Understand potential oligomerization interfaces and their functional significance.

  • Structural comparison opportunities:

    • Compare with bacterial CorA and other MRS2 family members to identify plant-specific adaptations.

    • Determine how structural differences correlate with functional specialization among family members.

    • Understand the structural basis for differential subcellular targeting (e.g., how MRS2-1's structure enables tonoplast localization).

  • Structure-guided engineering:

    • Enable rational design of mutations to alter transport properties or regulation.

    • Identify potential sites for chemical regulation or inhibition.

    • Guide the development of MRS2-1 variants with enhanced activity or novel properties.

What potential roles might MRS2-1 play in plant responses to abiotic stresses beyond magnesium deficiency?

MRS2-1 may contribute to plant stress responses through several mechanisms:

  • Drought and osmotic stress tolerance:

    • Vacuolar magnesium accumulation mediated by MRS2-1 may contribute to osmotic adjustment .

    • Proper magnesium distribution could help maintain photosynthetic efficiency under water limitation.

    • The observed role of magnesium as a key osmoticum under certain conditions suggests broader relevance to osmotic stress responses .

  • Metal toxicity responses:

    • MRS2-1-mediated magnesium homeostasis may influence tolerance to toxic metals that compete with magnesium.

    • Vacuolar sequestration of excess magnesium could prevent cytotoxicity under high magnesium conditions.

    • The specificity of MRS2-1 for magnesium over potentially toxic divalent metal ions could affect metal stress tolerance.

  • Oxidative stress management:

    • Magnesium is essential for chlorophyll structure and function, thus proper distribution may prevent oxidative damage under stress.

    • Maintaining optimal magnesium levels in different compartments could protect metalloproteins from oxidative damage.

  • Low calcium tolerance:

    • Research has already demonstrated that MRS2-1 is particularly important under serpentine conditions (low calcium) .

    • Understanding how MRS2-1 facilitates adaptation to low calcium could reveal broader calcium-magnesium antagonism mechanisms relevant to various stress conditions.

Research has specifically implicated magnesium as a key osmoticum required to maintain growth in low calcium concentrations in Arabidopsis, with MRS2-1 contributing to this adaptation mechanism . This suggests that MRS2-1 may have evolved functions beyond basic nutrient transport that help plants cope with variable or challenging environmental conditions.

How might the study of MRS2-1 in Arabidopsis inform our understanding of magnesium transport in non-plant systems?

Insights from MRS2-1 research in Arabidopsis can inform our understanding of magnesium transport across kingdoms:

  • Evolutionary conservation insights:

    • The functional complementation of yeast mrs2 mutants by Arabidopsis MRS2-1 demonstrates deep evolutionary conservation of transport mechanisms .

    • Comparing plant MRS2 transporters with bacterial CorA and mammalian SLC41 transporters can reveal core functional principles versus kingdom-specific adaptations.

    • The critical importance of the GMN motif across diverse organisms highlights fundamental structural requirements for magnesium transport .

  • Specialized regulatory mechanisms:

    • Plant-specific regulatory mechanisms discovered for MRS2-1 might suggest analogous but undiscovered mechanisms in other organisms.

    • The tissue-specific expression patterns and subcellular targeting of plant MRS2 transporters may provide insights into how magnesium transport is organized in complex multicellular organisms.

  • Methodological advances:

    • Techniques developed to study MRS2-1 in plants, such as the mag-fura-2 system for measuring magnesium transport , can be adapted for use in other systems.

    • Approaches for analyzing the impact of magnesium transport on specific physiological processes in plants may inspire similar studies in other organisms.

  • Therapeutic relevance:

    • Understanding how plants regulate magnesium homeostasis through MRS2-1 and related transporters may inform research on human magnesium transporters, which are increasingly recognized as important in various pathologies.

    • Plant-based expression systems for recombinant MRS2-1 could potentially be used to produce and study related transporters from other organisms.

The basic mechanism of magnesium transport appears conserved across diverse life forms, from bacteria to plants and animals. Studies in the model plant Arabidopsis, with its powerful genetic tools and extensive genomic resources, can provide insights that might be more difficult to obtain in other systems, potentially benefiting our understanding of magnesium transport across the tree of life.

What novel technologies could advance our understanding of MRS2-1 function and regulation in the coming years?

Several emerging technologies hold promise for advancing MRS2-1 research:

  • Advanced imaging technologies:

    • Super-resolution microscopy to visualize MRS2-1 distribution and dynamics at nanoscale resolution.

    • Correlative light and electron microscopy to precisely localize MRS2-1 in cellular ultrastructure.

    • Single-molecule imaging to track individual MRS2-1 proteins and their interactions in living cells.

    • Genetically encoded magnesium sensors for real-time visualization of magnesium fluxes in relation to MRS2-1 activity.

  • High-throughput phenotyping platforms:

    • Automated plant phenotyping systems to detect subtle growth and developmental effects of MRS2-1 modifications.

    • Multi-omics approaches integrating transcriptomics, proteomics, metabolomics, and ionomics to comprehensively assess MRS2-1 impact.

    • Machine learning algorithms to identify complex phenotypic signatures associated with altered MRS2-1 function.

  • Precision genome editing technologies:

    • Base editing and prime editing for precise modification of MRS2-1 without double-strand breaks.

    • Multiplexed CRISPR systems for simultaneous modification of multiple MRS2 family members.

    • Inducible or tissue-specific CRISPR systems for spatiotemporal control of MRS2-1 disruption.

  • Structural biology advances:

    • Cryo-electron microscopy for high-resolution structural analysis of membrane proteins like MRS2-1.

    • Hydrogen-deuterium exchange mass spectrometry to study conformational dynamics.

    • Advanced computational modeling incorporating molecular dynamics simulations to predict MRS2-1 behavior.

  • Single-cell approaches:

    • Single-cell transcriptomics to analyze cell-type-specific expression patterns of MRS2-1.

    • Single-cell ionomics to correlate MRS2-1 expression with magnesium content at cellular resolution.

    • Patch-seq combining electrophysiology and transcriptomics in the same cell.

These technologies would complement the established approaches used in current MRS2-1 research, such as X-ray microanalysis for cell-specific vacuolar elemental profiling and the mag-fura-2 system for direct measurement of magnesium transport , potentially providing unprecedented insights into the dynamics and regulation of plant magnesium transport.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.