Recombinant Arabidopsis thaliana Magnesium transporter MRS2-2 (MRS2-2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MRS2-2; MGT9; At5g64560; MUB3.8; Magnesium transporter MRS2-2; Magnesium Transporter 9; AtMGT9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-394
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
MRS2-2
Target Protein Sequence
MAQNGYLVPADPSAVVTVKKKTPQASWALIDATGQSEPLDVDKYEIMHRVQIHARDLRIL DPNLSYPSTILGRERAIVLNLEHIKAIITSEEVLLRDPSDENVIPVVEELRRRLPVGNAS HNGGQGDGKEIAGAQNDGDTGDEDESPFEFRALEVALEAICSFLAARTAELETAAYPALD ELTSKISSRNLDRVRKLKSAMTRLTARVQKVRDELEQLLDDDDDMADLYLSRKLSSASSP ISSIGEPNWYTTSPTIGSKISRASRASLATVHGDENDVEELEMLLEAYFMQIDSTLNRLT TLREYIDDTEDYINIQLDNHRNQLIQLELVLSSGTVCLSMYSLVAGIFGMNIPYTWNDGH GYMFKYVVGLTGTLCVVVFVIIMSYARYKGLVGS
Uniprot No.

Target Background

Function

A low-affinity magnesium transporter mediating magnesium influx. It plays a critical role in male gametophyte development and male fertility.

Gene References Into Functions
  1. AtMGT9 functions as a low-affinity Mg2+ transporter essential for pollen development. [MGT9] PMID: 19436262
Database Links

KEGG: ath:AT5G64560

STRING: 3702.AT5G64560.1

UniGene: At.9122

Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35.5) family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the whole plant but preferentially in the mature anthers.

Q&A

What is the MRS2-2 magnesium transporter in Arabidopsis thaliana?

MRS2-2 (also known as MGT9, gene locus At5g64560) is a member of the MRS2/MGT family of magnesium transporters in Arabidopsis thaliana. It belongs to the CorA-MRS2-ALR superfamily of membrane proteins, which are characterized by a conserved GMN (Gly-Met-Asn) tripeptide motif at the end of the first of two C-terminal transmembrane domains . The protein is 394 amino acids in length and functions as a magnesium transporter across biological membranes . Like other members of this family, MRS2-2 likely forms oligomeric structures in the membrane to create a functional transport channel .

What is the tissue-specific expression pattern of MRS2-2 in Arabidopsis?

MRS2-2 shows a highly specific expression pattern in Arabidopsis, primarily localized to vascular tissues. Studies using promoter-GFP fusions have demonstrated that MRS2-2 expression is concentrated in the vascular system throughout plant development . Specifically, MRS2-2 expression has been observed in the veins during early bud development, and examination of shoot cross-sections with xylem counterstaining using safranin has confirmed that MRS2-2 is predominantly expressed in the phloem . This vascular-specific expression pattern suggests that MRS2-2 may play a specialized role in magnesium transport and distribution within the plant's vascular system, potentially mediating long-distance transport of magnesium from roots to shoots .

What are the recommended approaches for studying MRS2-2 subcellular localization?

Several methodological approaches have proven effective for determining the subcellular localization of MRS2-2:

  • GFP Fusion Constructs: Creating translational fusions of MRS2-2 to the N-terminus of GFP allows visualization of protein localization in living cells. Both full-length and C-terminally truncated constructs should be tested to rule out interference from targeting signals .

  • Transient vs. Stable Expression: Multiple approaches should be employed, including both transient expression in protoplasts and stable expression in Arabidopsis plants. Transient expression offers rapid results, while stable expression provides more physiologically relevant conditions .

  • Co-localization Studies: Use organelle-specific markers (such as ER-Tracker) alongside the GFP-tagged MRS2-2 to confirm the precise subcellular compartment where the protein resides .

  • Complementation Testing: When using GFP fusions, confirm that the fusion protein remains functional by testing for complementation of mrs2-2 mutant phenotypes .

  • Membrane Fractionation: Biochemical approaches using membrane fractionation and immunoblotting with anti-GFP antibodies can provide additional confirmation of the localization observed through microscopy .

The conflicting localization data reported for some MRS2 family members underscores the importance of using multiple, complementary approaches to definitively establish subcellular localization .

How can researchers effectively create and validate knockout or knockdown lines for MRS2-2?

Creating and validating MRS2-2 knockout or knockdown lines requires a systematic approach:

  • T-DNA Insertion Selection: Screen available T-DNA insertion collections (like SALK, SAIL, or GABI-Kat) for insertions in the MRS2-2 coding region, preferably in exons .

  • Homozygosity Confirmation: Genotype plants using PCR with gene-specific primers flanking the insertion site and T-DNA border primers to confirm homozygosity .

  • Transcript Analysis: Perform RT-PCR and qRT-PCR to confirm complete absence (knockout) or reduction (knockdown) of MRS2-2 transcripts .

  • Protein Verification: When antibodies are available, use Western blotting to confirm absence of the MRS2-2 protein.

  • Magnesium Sensitivity Testing: Evaluate growth under various magnesium concentrations (20-1000 μM Mg²⁺) to detect magnesium-dependent phenotypes .

  • Growth Conditions Optimization: Single MRS2 gene knockouts often require specific conditions to manifest phenotypes. Hydroponic culture systems allow precise control of nutrient concentrations .

  • Multiple Knockout Combinations: Consider creating double or triple knockouts with phylogenetically related MRS2 genes (such as MRS2-1, MRS2-5, and MRS2-10 within clade B) to overcome functional redundancy .

  • Complementation Tests: Confirm that reintroducing the MRS2-2 gene rescues the mutant phenotype to verify that observed effects are specifically due to MRS2-2 disruption .

What techniques are most effective for assessing MRS2-2 magnesium transport activity in vitro?

Several sophisticated approaches can be employed to directly measure MRS2-2 transport activity:

  • Heterologous Expression Systems: Expression of MRS2-2 in yeast mrs2 mutants provides a clean system for functional complementation assays. The degree of growth restoration on non-fermentable carbon sources (like glycerol) correlates with magnesium transport efficiency .

  • Mag-fura-2 Fluorescent Assays: This real-time fluorescence-based method allows direct measurement of Mg²⁺ transport kinetics. The dye undergoes a spectral shift (380 nm to 340 nm excitation wavelength) upon Mg²⁺ binding, enabling quantitative measurement of transport rates across membranes .

  • Proteoliposome Reconstitution: Purified MRS2-2 protein can be reconstituted into proteoliposomes to study its transport properties in a defined membrane environment. This approach has successfully demonstrated Mg²⁺ transport by related MRS2 family members .

  • Isotope Flux Experiments: Using radioactive ²⁸Mg²⁺ or stable isotopes with ICP-MS detection can provide quantitative measures of transport rates and substrate specificity.

  • Electrophysiological Techniques: Patch-clamp recordings of MRS2-2-expressing cells or planar lipid bilayers containing reconstituted protein can provide detailed biophysical characterization of transport properties.

  • Competitive Inhibition Studies: Testing transport in the presence of other divalent cations (Ca²⁺, Mn²⁺, Ni²⁺, Co²⁺, Al³⁺) can reveal substrate specificity and potential inhibitory mechanisms .

For example, when using the mag-fura-2 method with reconstituted proteins, researchers have observed rapid Mg²⁺ uptake within minutes of external Mg²⁺ application, with different MRS2 family members showing varying transport efficiencies .

How can protein-protein interactions between MRS2-2 and other magnesium transporters be investigated?

Investigating protein-protein interactions between MRS2-2 and other magnesium transporters requires multiple complementary approaches:

  • Mating-Based Split-Ubiquitin System (mbSUS): This yeast-based technique has been successfully applied to study MRS2 protein interactions. The system allows detection of membrane protein interactions by reconstituting split ubiquitin when two membrane proteins interact, leading to reporter gene activation .

  • Bimolecular Fluorescence Complementation (BiFC): By fusing complementary fragments of a fluorescent protein to potential interaction partners, researchers can visualize protein interactions in planta through fluorescence reconstitution where the proteins interact.

  • Co-Immunoprecipitation (Co-IP): Using epitope-tagged versions of MRS2-2 and potential interaction partners, followed by immunoprecipitation and western blotting, can confirm interactions biochemically.

  • Mass Spectrometry-Based Interactomics: Affinity purification of MRS2-2 complexes followed by mass spectrometry can identify novel interaction partners.

  • FRET/FLIM Analysis: Förster resonance energy transfer (FRET) between fluorophore-tagged proteins can provide evidence of close proximity indicative of interaction in living cells.

Published research has demonstrated that AtMRS2 proteins can engage in both homologous and heterologous protein-protein interactions to varying degrees . Specifically, mbSUS experiments have shown that MRS2-2, like other AtMRS2 proteins, can interact with itself (homo-oligomerization) and with other family members (hetero-oligomerization) . These interactions are believed to be important for forming the functional pentameric channel structure that mediates magnesium transport across membranes.

How does MRS2-2 contribute to magnesium homeostasis in Arabidopsis?

The exact role of MRS2-2 in magnesium homeostasis is still being elucidated, but several lines of evidence provide insights:

  • Vascular Expression Pattern: MRS2-2's predominant expression in phloem tissues suggests a role in long-distance transport and distribution of magnesium throughout the plant .

  • Functionally Redundant Network: MRS2-2 functions as part of a network of magnesium transporters with partially overlapping functions. This redundancy may explain why single mrs2-2 knockout lines do not always display strong phenotypes under standard conditions .

  • Adaptation to Variable Mg²⁺ Environments: The MRS2 family collectively enables plants to adapt to a wide range of environmental magnesium concentrations. MRS2-2, along with other family members, contributes to this adaptability by regulating magnesium flux across cellular membranes .

  • Serpentine Adaptation: MRS2-2 and MRS2-7 have been identified as genes associated with serpentine adaptation in Arabidopsis lyrata, suggesting a role in adaptation to environments with low Ca²⁺/Mg²⁺ ratios .

  • Ca²⁺-Mg²⁺ Interplay: Research has shown that growth defects caused by magnesium deficiency in multiple mrs2 knockout lines can be ameliorated by concomitantly reducing calcium supply, indicating that MRS2-2 and related transporters function within a broader network of divalent cation homeostasis .

The collective evidence suggests that MRS2-2 plays a specialized role in magnesium distribution via the vasculature, contributing to whole-plant magnesium homeostasis, particularly under challenging environmental conditions.

What molecular mechanisms regulate MRS2-2 expression and activity?

The regulation of MRS2-2 expression and activity involves multiple molecular mechanisms:

  • Transcriptional Regulation: Expression analysis suggests that MRS2-2 transcription is regulated in a tissue-specific manner, with predominant expression in vascular tissues . This indicates the presence of vascular-specific transcriptional regulatory elements in its promoter region.

  • Magnesium-Responsive Regulation: While direct evidence for MRS2-2 is limited, studies of related MRS2 family members have shown that their expression can be responsive to magnesium availability. The transcriptome of the mrs2-4-1 mutant under normal conditions resembles that of wild-type plants grown under low magnesium conditions, suggesting feedback regulation mechanisms .

  • Post-Translational Modifications: The iPTMnet database entry for MRS2-2 (Q9FLG2) suggests the protein may be subject to post-translational modifications that could regulate its activity or localization .

  • Oligomerization-Based Regulation: MRS2-2's activity is likely regulated through its assembly into homo- or hetero-oligomeric complexes. Interaction studies have shown that MRS2-2 can interact with other MRS2 family members, potentially forming mixed pentamers with altered transport properties .

  • Intracellular Magnesium Sensing: By analogy with the bacterial CorA system, MRS2-2 may function as both a transporter and a sensor of magnesium levels. In CorA, magnesium binding at the cytoplasmic domain causes conformational changes that regulate channel opening .

  • Divalent Cation Cross-Regulation: Evidence from multiple MRS2 knockout studies suggests interplay between calcium and magnesium homeostasis systems. Lowering calcium concentrations can ameliorate phenotypes caused by disruption of magnesium transport, suggesting regulatory crosstalk between these divalent cation systems .

Further research is needed to fully elucidate the specific regulatory mechanisms controlling MRS2-2 expression and activity under different environmental conditions and developmental stages.

How can researchers address functional redundancy when studying MRS2-2 in the context of the entire MRS2/MGT family?

Addressing functional redundancy in the MRS2/MGT family requires sophisticated experimental approaches:

  • Higher-Order Mutant Analysis: Creating double, triple, or higher-order knockout combinations within phylogenetically related clades is essential. For example, the mrs2-1/5/10 triple knockout in clade B showed severe phenotypes not observed in single mutants .

  • Conditional Phenotyping: Employing a range of growth conditions is crucial, including:

    • Various magnesium concentrations (from limiting to excess)

    • Different calcium-to-magnesium ratios

    • Serpentine soil conditions (low Ca²⁺/Mg²⁺ ratio)

    • Other abiotic stress conditions that may interact with magnesium homeostasis

  • Tissue-Specific Expression Analysis: Utilize techniques like:

    • Cell-type specific transcriptomics

    • In situ hybridization

    • Promoter-reporter fusions

    • Cell-specific proteomics
      These approaches can reveal unique expression patterns that suggest specialized functions .

  • Subcellular Localization Mapping: Comprehensive analysis of the subcellular localization of all family members can help identify those with unique membrane targets versus those with overlapping localization .

  • Transport Kinetics Differentiation: Detailed biochemical characterization of transport kinetics, substrate specificities, and inhibitor sensitivities can reveal functional differences masked by redundancy .

  • Heterologous Expression in Multiple Systems: Testing complementation in different model systems (yeast, bacteria, Xenopus oocytes) under varying conditions can highlight specialized functional properties .

  • Evolutionary Analysis: Examining conservation patterns, positive selection signatures, and ortholog performance across plant species can provide insights into specialized versus redundant functions .

Successful examples from the literature include the discovery that while single mrs2-1 and mrs2-5 knockouts showed no obvious phenotypes, the double mutant exhibited subtle alterations, and the triple mutant with mrs2-10 showed severe developmental retardation under limiting magnesium conditions .

What are the technical challenges in resolving contradictory findings about MRS2-2 subcellular localization?

Resolving contradictory localization findings for MRS2-2 and related transporters requires addressing several technical challenges:

  • Tag Position Effects: The position of fluorescent protein tags (N-terminal vs. C-terminal) can significantly impact localization. For instance, MRS2-4 localization results differed between studies using different tagging strategies . Researchers should:

    • Test both N- and C-terminal fusions

    • Create internal tag fusions when possible

    • Validate that tagged proteins retain functionality through complementation tests

  • Expression Level Artifacts: Overexpression can lead to mislocalization due to saturation of trafficking machinery. Solutions include:

    • Using native promoters instead of strong constitutive promoters

    • Creating stable transformants with moderate expression levels

    • Employing inducible expression systems to control protein levels

  • Cell Type-Specific Variations: MRS2 proteins may localize differently in different cell types. Address this by:

    • Examining localization in multiple cell types and tissues

    • Using tissue-specific promoters for expression in relevant cell types

    • Comparing results from heterologous systems with in planta observations

  • Membrane Dynamics and Trafficking: Transporters may relocalize under different conditions or during different developmental stages. Strategies include:

    • Time-course experiments during development

    • Testing localization under different magnesium concentrations

    • Examining protein trafficking using photoconvertible tags

  • Resolution Limitations: Distinguishing between adjacent membrane compartments (plasma membrane vs. tonoplast, or ER vs. Golgi) requires:

    • Super-resolution microscopy techniques

    • Co-localization with well-established compartment markers

    • Correlative light and electron microscopy

  • Biochemical Verification: Complement microscopy with biochemical approaches:

    • Membrane fractionation followed by immunoblotting

    • Protease protection assays to determine topology

    • Surface biotinylation for plasma membrane localization

  • Functional Validation: Ultimately, functional tests in defined compartments provide the most convincing evidence:

    • Complementation of organelle-specific magnesium transport mutants

    • Compartment-specific magnesium measurements using targeted sensors

    • Transport assays with isolated membrane vesicles

For example, research has shown discrepancies in MRS2-4 localization, with one study reporting plasma membrane localization and another demonstrating ER localization . The authors of the latter study provided multiple lines of evidence, including both genomic GFP fusions that complemented the mutant phenotype and consistent results with both N- and C-terminal fusions in BY-2 cells, making a strong case for ER localization .

What emerging technologies could advance our understanding of MRS2-2 structure-function relationships?

Several cutting-edge technologies show promise for elucidating MRS2-2 structure-function relationships:

  • Cryo-Electron Microscopy (cryo-EM): This technique has revolutionized membrane protein structural biology and could determine the structure of MRS2-2 pentamers in different conformational states, revealing gating mechanisms. Recent work on the human mitochondrial MRS2 channel provides a template for similar studies in plant MRS2 proteins .

  • AlphaFold2 and Related AI Structure Prediction: These tools can generate high-confidence structural models of MRS2-2 and its complexes, guiding experimental design. Integrating predicted structures with experimental validation could rapidly advance understanding of structure-function relationships.

  • Single-Molecule FRET: This approach can track conformational changes in individual MRS2-2 channels during transport cycles, providing insights into dynamics not accessible through static structural methods.

  • In-Cell NMR Spectroscopy: This emerging technique allows structural analysis of proteins in their native cellular environment, potentially revealing how cellular factors influence MRS2-2 structure.

  • Genetically Encoded Magnesium Sensors: Targeting these fluorescent biosensors to specific subcellular compartments allows real-time visualization of magnesium flux through MRS2-2 channels in living cells.

  • Nanodiscs and Styrene Maleic Acid Lipid Particles (SMALPs): These technologies enable membrane protein characterization in native-like lipid environments, addressing how membrane composition affects MRS2-2 function.

  • CRISPR-Mediated Precision Engineering: Beyond knockouts, precise modification of key residues in the endogenous MRS2-2 gene can test structure-function hypotheses in vivo without artifacts from transgene expression.

  • Molecular Dynamics Simulations: These computational approaches can model ion permeation, selectivity, and gating mechanisms based on structural data, generating testable hypotheses about MRS2-2 function.

How might research on MRS2-2 contribute to improving plant adaptation to challenging soil conditions?

Research on MRS2-2 has significant potential applications for agricultural improvement:

  • Enhanced Serpentine Soil Adaptation: MRS2-2 and MRS2-7 have been implicated in adaptation to serpentine soils (low Ca²⁺/Mg²⁺ ratio) . Understanding their regulatory mechanisms could lead to:

    • Development of crops with improved growth on serpentine or ultramafic soils

    • Engineering of plants for phytoremediation of magnesium-contaminated sites

    • Selection of varieties with enhanced tolerance to imbalanced Ca²⁺/Mg²⁺ ratios

  • Magnesium Use Efficiency: Optimizing MRS2-2 expression or activity could enhance:

    • Plant growth under magnesium-limited conditions

    • Redistribution of magnesium to photosynthetically active tissues

    • Seed loading with magnesium to improve seedling vigor

  • Stress Tolerance Engineering: Given magnesium's role in chlorophyll and enzyme function, modulating MRS2-2 could improve:

    • Photosynthetic efficiency under suboptimal conditions

    • Drought tolerance, as magnesium contributes to osmotic adjustment

    • Cold tolerance, as proper magnesium distribution supports membrane integrity

  • Nutritional Enhancement: Biofortification strategies could leverage MRS2-2 to:

    • Increase magnesium content in edible plant parts

    • Improve magnesium bioavailability in food crops

    • Balance mineral nutrients for improved human nutrition

  • Climate Change Adaptation: As climate change alters soil chemistry and water availability:

    • MRS2-2 variants optimized for different soil conditions could be selected

    • MRS2-2 regulatory elements responsive to environmental cues could be utilized

    • Integration of MRS2-2 modifications with other adaptive traits could create climate-resilient crops

  • Precision Agriculture Applications: MRS2-2 expression could serve as:

    • A biosensor for magnesium deficiency before visible symptoms appear

    • A tool for optimizing fertilizer application timing and amounts

    • A marker for selection of locally adapted varieties

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.