Recombinant Arabidopsis thaliana Magnesium transporter MRS2-3 (MRS2-3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its inclusion.
Synonyms
MRS2-3; MGT4; At3g19640; MMB12.11; Magnesium transporter MRS2-3; Magnesium Transporter 4; AtMGT4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-484
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
MRS2-3
Target Protein Sequence
MRGARPDEFNFSTNPSTPNTGQPTPTYPAGVGGGGGGRKKGVGVRTWLVLNSSGQSEPKE EGKHSIMRRTGLPARDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQEVLLLNSKD PSVSPFIDELQRRILCHHHATKPQEEQNSGGEPHTRVDPAQGEAGTEQSSGDQGSEAKKD AKQSLENQDGSKVLPFEFVALEACLEAASSSLEHEALRLELEAHPALDKLTSKISTLNLE RVRQIKSRLVAITGRVQKVRDELEHLLDDDEDMAEMYLTEKLAQKLEDSSNSSMNESDTF EVDLPQGDEDDRLPPEFASEANRDGRYLQANDAHELLMSTQSALSRNSRGTHTSSTRSAM TNKLDVEELEMLLEAYFVQIDGILNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLT TATLVMSAFIAVAGVFGMNITIELFTDNKHGPSRFIWTVIGGSIGSICLYVGAIGWCKYK RLLE
Uniprot No.

Target Background

Function
Magnesium transporter mediating magnesium influx.
Database Links

KEGG: ath:AT3G19640

STRING: 3702.AT3G19640.1

UniGene: At.20611

Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35.5) family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the whole plant.

Q&A

What is the MRS2/MGT gene family in Arabidopsis thaliana and how is MRS2-3 classified within this family?

The MRS2/MGT gene family in Arabidopsis thaliana belongs to the superfamily of CorA-MRS2-ALR-type membrane proteins characterized by a GMN tripeptide motif (Gly-Met-Asn) at the end of the first of two C-terminal transmembrane domains. These proteins have been identified as magnesium transporters across various organisms. MRS2-3, also known as MGT4 or AtMGT4, is one of approximately ten members in the Arabidopsis MRS2/MGT gene family . The family has been organized into distinct clades (A through E) based on characteristic intron insertion sites, with each member showing unique expression patterns and potentially specialized functions in magnesium homeostasis .

How do functional complementation assays in yeast systems demonstrate MRS2-3 transport activity?

Functional complementation assays using Saccharomyces cerevisiae mrs2 mutants provide a powerful approach to characterize MRS2-3 transport activity. Research has shown that all members of the Arabidopsis MRS2/MGT family can complement the corresponding yeast mrs2 mutant, albeit with different efficiencies .

The complementation procedure involves:

  • Transforming the yeast mrs2 mutant (which exhibits respiratory deficiency) with constructs expressing Arabidopsis MRS2/MGT proteins.

  • Assessing growth restoration on non-fermentable medium with glycerol as the main carbon source (YPdG).

  • Comparing growth with positive controls (native yeast Mrs2p) and negative controls (empty vector).

  • Performing direct measurements of Mg²⁺ uptake using the mag-fura-2 system to quantify transport efficiency .

These approaches reveal functional conservation between plant and yeast magnesium transporters while allowing quantitative assessment of transport activity. For MRS2-3 specifically, researchers should consider measuring magnesium uptake rates under various conditions to characterize its kinetic properties and substrate specificity .

What approaches can be used to study the subcellular localization of MRS2-3, and how does this affect experimental design?

Determining the subcellular localization of MRS2-3 requires multiple complementary approaches:

  • GFP fusion constructs: Creating fusion proteins between MRS2-3 and green fluorescent protein (GFP) allows visualization after transient transformation into plant protoplasts. This approach has revealed that different MRS2/MGT family members may target different cellular membranes, including the tonoplast and potentially other organellar membranes .

  • Subcellular fractionation: Isolating different membrane fractions (plasma membrane, tonoplast, mitochondria, etc.) followed by immunoblotting can confirm the presence of MRS2-3 in specific compartments.

  • Immunolocalization: Using specific antibodies against MRS2-3 for transmission electron microscopy can provide high-resolution localization data.

  • Bioinformatic prediction: Analyzing targeting sequences within the MRS2-3 protein sequence can predict potential localization. For example, some MRS2 family members contain mitochondrial targeting sequences while others do not .

The subcellular localization critically impacts experimental design, as it determines which cellular compartments should be isolated when studying MRS2-3 function and which control proteins should be used as markers for specific membranes .

How can T-DNA insertion knockout lines be effectively used to investigate MRS2-3 function in planta?

T-DNA insertion knockout lines provide valuable tools for investigating MRS2-3 function in plants. Based on approaches used for other MRS2/MGT family members, researchers should:

  • Select and confirm knockout lines: Identify T-DNA insertion lines disrupting the MRS2-3 gene and confirm homozygosity through PCR genotyping. Verify complete loss of transcript using RT-PCR or RNA-seq analysis.

  • Conduct phenotypic analyses under varying magnesium conditions: Growing knockout lines under different magnesium concentrations (e.g., standard conditions and reduced magnesium supply of ~50 μM Mg²⁺) is crucial, as phenotypes may only become apparent under specific nutrient conditions .

  • Create multiple knockout combinations: Since functional redundancy exists within the MRS2/MGT family, generating double or triple knockout lines combining mrs2-3 with other family members may be necessary to observe clear phenotypes, as demonstrated with other MRS2 genes .

  • Perform cellular magnesium measurements: Quantify magnesium content in different tissues and cellular compartments using techniques like X-ray microanalysis to detect potentially subtle changes in magnesium distribution .

  • Conduct complementation studies: Reintroduce the MRS2-3 gene into the knockout background to confirm that observed phenotypes are directly attributable to the gene's absence .

What are the challenges in distinguishing the specific roles of MRS2-3 from other MRS2/MGT family members?

Distinguishing the specific roles of MRS2-3 from other family members presents several significant challenges:

  • Functional redundancy: Multiple MRS2/MGT transporters may have overlapping functions, making single gene knockout phenotypes subtle or absent. Research has shown that even double knockout lines of some MRS2 genes (mrs2-1 mrs2-5 and mrs2-5 mrs2-10) showed no impairment of plant growth and development, despite strong and overlapping gene expression patterns .

  • Conditional phenotypes: Some MRS2/MGT family members only display phenotypes under specific conditions, such as the mrs2-7 knockout, which exhibits a strong magnesium-dependent phenotype only when substrate magnesium supply is lowered to 50 μM Mg²⁺ .

  • Tissue-specific expression overlap: Different MRS2/MGT transporters may be co-expressed in the same tissues but in different cell types or developmental stages, requiring precise spatial and temporal expression analysis .

  • Protein interaction networks: MRS2-3 may function within larger protein complexes, with its role being influenced by interactions with other proteins that may vary between cell types or conditions.

  • Substrate specificity variations: Though primarily characterized as magnesium transporters, potential differences in ion selectivity or transport kinetics between family members require detailed electrophysiological studies .

What are the optimal conditions for expressing and purifying recombinant MRS2-3 protein?

Optimal expression and purification of recombinant MRS2-3 protein involves several key considerations:

  • Expression system selection: While E. coli is commonly used for recombinant MRS2-3 protein production, membrane proteins often present challenges in bacterial systems. The recombinant His-tagged MRS2-3 protein (1-484aa) has been successfully expressed in E. coli .

  • Construct design: Including an N-terminal His-tag facilitates purification while maintaining protein function. The full-length construct (484 amino acids) should be used to preserve all functional domains .

  • Induction conditions:

    • Temperature: Lower temperatures (16-18°C) often improve membrane protein folding

    • Inducer concentration: Typically 0.1-0.5 mM IPTG for His-tagged MRS2-3

    • Duration: Extended induction periods (12-16 hours) at lower temperatures

  • Purification protocol:

    • Lysis buffer: Tris/PBS-based buffer at pH 8.0 containing appropriate detergents

    • Affinity chromatography: Ni-NTA resin for His-tagged proteins

    • Storage: Lyophilized powder or in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

  • Quality control:

    • SDS-PAGE analysis: Ensure >90% purity

    • Western blot: Confirm identity using anti-His antibodies

    • Functional assays: Verify activity through reconstitution in liposomes or complementation in yeast systems

How can researchers effectively measure magnesium transport activity of recombinant MRS2-3 in heterologous systems?

Measuring magnesium transport activity of recombinant MRS2-3 in heterologous systems can be accomplished through several approaches:

  • Yeast complementation system:

    • Transform mrs2-deficient Saccharomyces cerevisiae strains with MRS2-3 expression constructs

    • Assess growth restoration on non-fermentable carbon sources (e.g., YPdG medium)

    • Quantify growth rates under varying magnesium concentrations

  • Direct magnesium uptake measurements:

    • Use the mag-fura-2 fluorescence system to directly measure Mg²⁺ uptake into yeast mitochondria

    • Monitor fluorescence changes over time following addition of external magnesium

    • Calculate initial uptake rates and compare with control transporters

  • Electrophysiological approaches:

    • Reconstitute purified MRS2-3 in artificial lipid bilayers

    • Measure ion currents under voltage-clamp conditions

    • Determine ion selectivity by changing ionic compositions

  • Isotope flux experiments:

    • Use radioactive ²⁸Mg²⁺ to track magnesium movement across membranes

    • Compare uptake kinetics under varying conditions and concentrations

    • Determine Km and Vmax values to characterize transport efficiency

  • Competition assays:

    • Test whether other divalent cations compete with Mg²⁺ transport

    • Identify potential inhibitors of transport activity

    • Characterize substrate specificity profile

What strategies can be employed to investigate MRS2-3 protein interactions with other cellular components?

Investigating MRS2-3 protein interactions requires multiple complementary approaches:

  • Co-immunoprecipitation (Co-IP):

    • Express tagged MRS2-3 in plant tissues or heterologous systems

    • Isolate protein complexes using antibodies against the tag

    • Identify interacting partners through mass spectrometry

    • Confirm interactions with specific candidate proteins through reciprocal Co-IP

  • Yeast two-hybrid (Y2H) screening:

    • Use modified Y2H systems optimized for membrane proteins

    • Screen Arabidopsis cDNA libraries to identify potential interactors

    • Validate positive interactions through targeted Y2H assays

  • Bimolecular Fluorescence Complementation (BiFC):

    • Fuse MRS2-3 and candidate interactors to complementary fragments of fluorescent proteins

    • Co-express in plant protoplasts or leaf cells

    • Visualize interactions through fluorescence microscopy

    • Map interaction domains through deletion constructs

  • Proximity-dependent labeling:

    • Fuse MRS2-3 to enzymes like BioID or APEX

    • Identify proximal proteins through biotinylation and subsequent purification

    • This approach is particularly valuable for identifying transient interactions

  • Genetic interaction studies:

    • Cross mrs2-3 knockout lines with mutants of candidate interactors

    • Analyze phenotypes of double mutants for evidence of genetic interaction

    • Look for synthetic lethal/sick interactions or phenotype rescue

What techniques are most effective for analyzing the impact of MRS2-3 mutations on magnesium homeostasis in plants?

Several complementary techniques can effectively analyze the impact of MRS2-3 mutations on magnesium homeostasis:

  • X-ray microanalysis for cell-specific magnesium measurements:

    • Preparation of leaf tissues using appropriate fixation protocols

    • Analysis of vacuolar elemental profiles in different cell types

    • Quantification of magnesium concentrations at the subcellular level

    • This approach has successfully revealed cell-specific magnesium distributions in wild-type and mutant Arabidopsis plants

  • ICP-MS (Inductively Coupled Plasma Mass Spectrometry):

    • Digest plant tissues from different organs to measure total magnesium content

    • Compare wild-type and mrs2-3 mutant plants under various growth conditions

    • Quantify potential compensation by other transport systems

  • Transcriptomic analysis:

    • Perform RNA-seq on mrs2-3 mutants to identify compensatory changes in gene expression

    • Focus on other magnesium transporters and magnesium-dependent processes

    • Analyze under both standard and magnesium-limited conditions

  • Fluorescent magnesium indicators:

    • Use magnesium-sensitive fluorescent dyes (e.g., Mag-Fura-2) in live cell imaging

    • Monitor magnesium dynamics in different cellular compartments

    • Compare wild-type and mrs2-3 mutant responses to magnesium fluctuations

  • Physiological assays under varying magnesium conditions:

    • Establish growth matrices with different magnesium concentrations (e.g., standard and reduced to 50 μM Mg²⁺)

    • Measure growth parameters, photosynthetic efficiency, and stress responses

    • Particularly important since magnesium-dependent phenotypes may only emerge under specific conditions, as observed with other MRS2 family members

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.