Recombinant Arabidopsis thaliana Magnesium transporter MRS2-4 (MRS2-4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
MRS2-4; MGT6; At3g58970; F17J16.20; Magnesium transporter MRS2-4; Magnesium Transporter 6; AtMGT6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-436
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
MRS2-4
Target Protein Sequence
MGKGPLSFRRLSSIRHRKKGSAVKDDSAQTSTPSSPPPPLPIHAGGSAVGATGKAKKKTG GARLWMRFDRTGAMEVVECDKSTIIKRASVPARDLRILGPVFSHSSNILAREKAIVVNLE VIKAIVTAEEVLLLDPLRPEVLPFVERLKQQFPQRNGNENALQASANVQSPLDPEAAEGL QSELPFEFQVLEIALEVVCSFVDKSVAALETEAWPVLDELTKNVSTENLEYVRSLKSNLT RLLARVQKVRDELEHLLDDNEDMADLYLTRKWIQNQQTEAILAGTASNSIALPAHNTSNL HRLTSNRSASMVTSNTEEDDVEDLEMLLEAYFMQLDGMRNKILTVREYIDDTEDYVNIQL DNQRNELIQLQLTLTIASFAIAAETLLASLFGMNIPCPLYSIHGVFGYFVWSVTALCIVL FMVTLGYARWKKLLGS
Uniprot No.

Target Background

Function
Recombinant *Arabidopsis thaliana* Magnesium transporter MRS2-4 (MRS2-4) is a magnesium transporter that mediates magnesium influx.
Gene References Into Functions
  1. MRS2-4 plays a crucial role in adapting to both low and high magnesium conditions, and is essential for magnesium uptake under normal conditions. PMID: 26748081
Database Links

KEGG: ath:AT3G58970

STRING: 3702.AT3G58970.1

UniGene: At.49665

Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35.5) family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the whole plant except roots.

Q&A

What is the subcellular localization of MRS2-4?

MRS2-4 is primarily localized to the endoplasmic reticulum (ER). This localization has been confirmed through MRS2-4-green fluorescent protein (GFP) fusion studies, which showed that the protein is mainly detected in the ER . This suggests that MRS2-4 plays a role in intracellular magnesium distribution rather than direct uptake from the external environment, potentially facilitating magnesium transport between cellular compartments.

What phenotypes are observed in MRS2-4 mutant plants?

MRS2-4 knockout mutants exhibit several distinct phenotypes:

  • Growth defects under low magnesium conditions

  • Sensitivity to high calcium conditions without magnesium supplementation

  • Lower magnesium concentration compared to wild-type plants even under normal magnesium conditions

  • Sensitivity to high levels of magnesium

Notably, a double mutant lacking both MRS2-4 and MRS2-7 shows growth defects even under normal magnesium concentrations, indicating functional redundancy between these two transporters .

How does MRS2-4 contribute to magnesium homeostasis?

MRS2-4 is essential for magnesium homeostasis under both low and high magnesium conditions. The transcriptome profiles of mrs2-4-1 mutants under normal conditions resemble those of wild-type plants grown under low magnesium conditions, suggesting that MRS2-4 mutants experience magnesium deficiency even when external magnesium is adequate . This indicates that MRS2-4 is crucial for maintaining proper cellular magnesium levels and distribution. The protein's localization to the ER suggests it facilitates magnesium transport between intracellular compartments, which is essential for proper plant development and adaptation to varying environmental magnesium concentrations .

What methods can be used to assess MRS2-4 transport activity?

Several experimental approaches can be employed to study MRS2-4 transport activity:

  • Heterologous Expression Systems: MRS2-4 can be expressed in yeast mrs2 mutants to assess functional complementation. Growth on non-fermentable medium with glycerol as the main carbon source (YPdG) can reveal restoration of the respiratory-deficient phenotype .

  • Mag-fura-2 Transport Assay: This UV-excitable, Mg²⁺-dependent fluorescent indicator undergoes a blue shift from 380 to 340 nm upon Mg²⁺ binding. Mitochondria isolated from yeast strains transformed with MRS2-4 constructs can be loaded with mag-fura-2 to measure magnesium uptake after external application of increasing Mg²⁺ concentrations .

  • Recombinant Protein Studies: Full-length recombinant MRS2-4 protein (as described in search result 5) can be used for in vitro transport studies. The protein can be reconstituted into liposomes to assess transport kinetics and ion selectivity.

  • Electrophysiological Methods: Patch-clamp techniques can be applied to study MRS2-4-mediated currents in heterologous expression systems or isolated membrane patches.

How do MRS2-4 and MRS2-7 interact functionally in magnesium homeostasis?

MRS2-4 and MRS2-7 exhibit functional redundancy in maintaining magnesium homeostasis, but with distinct roles:

  • Single mrs2-4 mutants show growth defects under low magnesium conditions, while mrs2-4 mrs2-7 double mutants exhibit defects even under normal magnesium concentrations .

  • Both mrs2-4 and mrs2-7 mutants are sensitive to high levels of magnesium, indicating their importance in preventing magnesium toxicity .

  • MRS2-7 is predominantly expressed in roots and appears to be involved in magnesium uptake from soil. Three independent single-gene knockouts of root-expressed MRS2-7 showed strong magnesium-dependent phenotypes when substrate magnesium supply was lowered to 50 μM Mg²⁺ .

  • MRS2-4 is primarily involved in intracellular magnesium distribution through its localization in the ER .

This complementary expression pattern suggests that MRS2-7 contributes to initial magnesium uptake, while MRS2-4 facilitates intracellular magnesium distribution and homeostasis.

What transcriptomic changes occur in MRS2-4 mutants?

Transcriptome analysis of mrs2-4-1 mutants under normal magnesium conditions revealed profiles similar to those of wild-type plants grown under low magnesium conditions . This suggests that:

  • MRS2-4 mutants experience a physiological state of magnesium deficiency even when external magnesium supply is normal.

  • There is likely a set of genes specifically regulated in response to cellular magnesium status.

  • The transcriptional response to magnesium deficiency may involve signaling pathways that detect intracellular rather than extracellular magnesium levels.

This transcriptome signature could be used as a molecular marker for magnesium deficiency in plants and provides insight into the downstream effects of disrupted magnesium homeostasis.

How is MRS2-4 involved in calcium-magnesium interactions in plant cells?

MRS2-4 plays a critical role in the relationship between calcium and magnesium homeostasis:

  • Arabidopsis mrs2-4 mutants are sensitive to high calcium conditions without magnesium supplementation .

  • Magnesium may serve as a key osmoticum required to maintain growth in low calcium concentrations in Arabidopsis .

  • In mesophyll vacuoles, MRS2 transporters (particularly MRS2-1 and MRS2-5) are important for magnesium partitioning, which becomes especially significant under serpentine conditions (low calcium, high magnesium) .

This suggests a complex interplay between calcium and magnesium homeostasis, with MRS2-4 serving as an important regulator in this balance. The protein may help plants adapt to varying calcium:magnesium ratios in the soil, which is particularly important in serpentine environments.

What structural features determine MRS2-4 transport specificity and regulation?

The structure-function relationship of MRS2-4 can be understood through several key features:

  • GMN Motif: Like other members of the CorA-MRS2-ALR superfamily, MRS2-4 contains the conserved GMN tripeptide motif essential for magnesium transport .

  • Transmembrane Domains: MRS2-4 has two C-terminal transmembrane domains, with the GMN motif positioned at the end of the first domain .

  • Protein Length: The full-length MRS2-4 protein consists of 436 amino acids , providing sufficient structural complexity for regulated transport.

  • Regulation Sites: Though not specifically detailed in the search results, proteins in this family typically have regulatory binding sites for divalent cations that modulate transport activity.

Understanding these structural elements is crucial for interpreting how MRS2-4 selectively transports magnesium ions and how this transport is regulated in response to changing cellular conditions.

How can recombinant MRS2-4 be used in structural and functional studies?

Recombinant MRS2-4 protein, such as the His-tagged full-length (1-436 aa) version expressed in E. coli , can be utilized in several experimental applications:

  • Crystallization and Structural Analysis: Purified recombinant protein can be used for X-ray crystallography or cryo-EM to determine the three-dimensional structure.

  • Binding Assays: To identify interaction partners and regulatory molecules that modulate MRS2-4 function.

  • Antibody Production: For immunolocalization studies to confirm subcellular localization in different plant tissues.

  • In vitro Transport Assays: Reconstitution into liposomes or proteoliposomes for direct measurement of transport kinetics and ion selectivity.

  • Site-Directed Mutagenesis: To investigate the role of specific amino acids in transport function, particularly those in the GMN motif and other conserved regions.

What approaches can be used to study tissue-specific expression of MRS2-4?

Several methods have been employed to investigate the tissue-specific expression of MRS2 family genes, which can be applied to MRS2-4:

  • Promoter-GUS Fusions: Fusions of the β-glucuronidase (GUS) reporter gene to the promoter region of MRS2-4 can be used to visualize expression patterns in different tissues and developmental stages .

  • Quantitative PCR (qPCR): This technique has been used to correlate transcript abundance with magnesium accumulation across different ecotypes and conditions .

  • Cell-Specific Transcriptomics: Microarray analysis has been used to identify cell-specific complements of magnesium transporters in different leaf cell types .

  • Green Fluorescent Protein (GFP) Fusion Proteins: MRS2-4-GFP fusions have been used to determine subcellular localization to the endoplasmic reticulum .

These approaches can provide comprehensive information about where and when MRS2-4 is expressed, offering insights into its physiological roles in different plant tissues.

How can MRS2-4 be utilized in crop improvement strategies?

Understanding MRS2-4 function offers several potential applications for crop improvement:

  • Enhanced Magnesium Use Efficiency: Overexpression of MRS2-4 could potentially improve plant growth under magnesium-limiting conditions, as suggested by the complementation and overcompensation of mrs2-7 mutants with a CaMV 35S promoter-driven MRS2-7 construct, which led to increased biomass accumulation under magnesium-limiting conditions .

  • Improved Stress Tolerance: Since proper magnesium homeostasis is critical for numerous cellular processes, optimizing MRS2-4 expression could enhance plant tolerance to various stresses.

  • Biofortification: Manipulating MRS2-4 and related transporters could potentially increase magnesium content in edible plant tissues, enhancing the nutritional value of crops.

  • Adaptation to Problematic Soils: Engineering plants with modified MRS2-4 expression could improve growth on serpentine soils (high magnesium, low calcium) or magnesium-deficient soils.

  • Marker-Assisted Selection: Using natural variation in MRS2-4 as a marker for selecting cultivars with improved magnesium use efficiency.

What is the relationship between MRS2-4 and other cellular processes?

MRS2-4 function intersects with numerous cellular processes:

  • Photosynthesis: Magnesium is a component of chlorophyll, and proper magnesium homeostasis mediated by MRS2-4 is likely essential for optimal photosynthetic efficiency.

  • Enzyme Activity: As a cofactor for >300 types of enzymes, including polymerases and kinases, magnesium levels regulated by MRS2-4 would impact numerous metabolic pathways .

  • Osmotic Regulation: Magnesium has been implicated as a key osmoticum required to maintain growth in low calcium concentrations, suggesting MRS2-4 plays a role in cellular osmotic balance .

  • Stress Responses: The transcriptome profiles of mrs2-4 mutants suggest connections to stress response pathways that are activated under magnesium deficiency conditions .

  • Calcium Signaling: The sensitivity of mrs2-4 mutants to high calcium conditions indicates an interplay between magnesium and calcium signaling networks .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.